www.fgks.org   »   [go: up one dir, main page]

Academia.eduAcademia.edu
UN CUERPO AMBULANTE A WANDERING BODY Sergio Zevallos en el Grupo Chaclacayo (1982-1994) Sergio Zevallos in the Grupo Chaclacayo (1982-1994) 2 3 UN CUERPO AMBULANTE Sergio Zevallos en el Grupo Chaclacayo (1982-1994) Editado por / Edited by Miguel A. López A WANDERING BODY Sergio Zevallos in the Grupo Chaclacayo (1982-1994) PUBLICACIÓN Edición Miguel A. López Coordinación editorial Gabriela Germaná Concepto y diseño YP HVWXGLRJUiÀFR Ralph Bauer 9HUyQLFD0DMOXI Traducción 5HEHFFD&ORVH Melanie Gallagher Flavia López de Romaña Valerie Berger Sharon Lerner Retoque 'DYLG)DUIiQ Impresión *UiÀFD%LEORV EXPOSICIÓN ‹GHODHGLFLyQ $VRFLDFLyQ0XVHRGH$UWH de Lima – MALI 3DVHR&ROyQ/LPD 7HOpIRQR www.mali.pe ‹'HORVWH[WRV los autores ‹'HODVREUDV los autores Curaduría Miguel A. López Coordinación Valeria Quintana Fotografía Daniel Giannoni Musuk Nolte Museografía -XDQ&DUORV%XUJD Nelson Munares 3ULPHUDHGLFLyQ HMHPSODUHV ISBN 978-9972-718-39-7 +HFKRHOGHSyVLWROHJDO HQOD%LEOLRWHFD1DFLRQDO del Perú 1ž² 3UR\HFWR(GLWRULDO 1ž Reservados todos los GHUHFKRV 3URKLELGDODUHSURGXFFLyQ WRWDORSDUFLDOVLQSUHYLD DXWRUL]DFLyQH[SUHVDGHO Museo de Arte de Lima – MALI Museo de Arte de Lima MALI 16 de noviembre de 2013 23 de marzo de 2014 Centro Cultural de España – Lima 16 de noviembre de 2013 19 de enero de 2014 Wüttembergischer Kunstverein Stuttgart Alemania GHRFWXEUHGH GHHQHURGH (O0XVHRGH$UWHGH/LPD ²0$/,WLHQHFRPRVHGH HOKLVWyULFR3DODFLRGH([SRVLFLyQJUDFLDVDOJHQHURVR DSR\RGHOD0XQLFLSDOLGDG Metropolitana de Lima AGRADECIMIENTOS DEL ARTISTA AGRADECIMIENTOS A Raúl Avellaneda y Helmut Psotta por los años TXHSDVDPRVMXQWRVKDFLHQGRHVWDREUD (VWHOLEURHVSRVLEOHJUDFLDVDODSR\RGH)RXQGDWLRQIRU $UWV,QLWLDWLYHV)I$, $)ULGR0DUWLQ6L[WR3DQLRUD-RUJHÉQJHOHV\.ODXV :LWWNDPSTXLHQHVIXHURQSDUWHGHODH[SHULHQFLD HQ&KDFODFD\R 8QDJUDGHFLPLHQWRHVSHFLDOD*LXVHSSH&DPSX]DQR\ al Museo Travesti del Perú. $OD'UXFNZHUNVWDWWLP.XOWXUZHUNGHVEENEHUOLQ*PE+ $O-RE&HQWHU3DQNRZGHOD%XQGHVDJHQWXUIU$UEHLW Berlin Nord. -RVp&DUORV$JHUR/XLV$OYDUDGR$OH[ÉQJHOHV/XF\ $QJXOR$UGQW%HFN/LYLD%HQDYLGHV.DUHQ%HUQHGR 0DQXHO%RUMD9LOOHO)HUQDQGR%U\FH*XVWDYR%XQWLQ[ -HV~V&DUULOOR)HUQDQGD&DUYDMDO)UDQFLVFR&DVDV &RVPLQ&RVWLQDV+DQV'&KULVW,ULV'UHVVOHU1XULD (QJXLWD9HUyQLFD)HUUDUL&pVDU*XHUUD,QWL*XHUUHUR 0LFKDHO+DHUGWHU6RO+HQDUR/RXUGHV+HUUHUD -DLPH+LJD(GXDUGR+LURVH*LRYDQQL,QIDQWH6RODQJH -DFREV-UJHQ.ODXNH3DEOR/DIXHQWH3HGUR/HPHEHO (QD/ySH]5HTXHQD$QVHOPR/ySH]5RMDV)LRUHOOD /ySH]$QD/RQJRQL)ULGR0DUWLQ$OIUHGR0iUTXH] &DUORV0RWWD*HUPDLQ0DFKXFD)HUQDQGD1RJXHLUD 0LFKDHO1XQJHVVHU(OLDQD2WWD7LOVD2WWD3LHUR3HUHLUD 5RVDULR3H\Uy9HQWXUD3RQV)ORUHQFLD3RUWRFDUUHUR %HDWUL]3UHFLDGR9DOHULD4XLQWDQD6DQWLDJR4XLQWDQLOOD *DEULHOD5DQJHO$QDOXFtD5LYHURV+HUEHUW5RGUtJXH] 0\ULDP5XELR-XDQ6iQFKH]&KULVWLQD6LFNHUW(PLOLR 7DUD]RQD6XVDQD7RUUHV$QWRLQH6FKZHLW]HU0DU\6RWR 0DULR8OORD-DYLHU9DUJDV6RWRPD\RU-XDQ&DUORV9HUPH -RUJH9LOODFRUWD)DLWK:LOGLQJ&DUORV/HyQ;MLPpQH] \9HUyQLFD=HOD $OH[DQGHU9HUODJ%HUOtQ%$.²%DVLVYRRUDNWXHOOH .XQVW 8WUHFKW $63$9'LDULR([SUHVR'LDULR/D 5HS~EOLFD*DOHULH/HORQJ*DOOHU\(OLVDEHWK  .ODXV7KRPDQ*RHWKH,QVWLWXW/LPD+HVVHO0XVHXP RI$UW\&HQWHUIRU&XUDWRULDO6WXGLHVGHO%DUG&ROOHJH 1XHYD<RUN ,QVWLWXWR&XOWXUDO3HUXDQR1RUWHDPHULFDQR ,&31$ .DOOL5ROIH&RQWHPSRUDU\$UW0LFURPXVHR ´al fondo hay sitioµ 0+2/0RYLPLHQWR+RPRVH[XDO GH/LPD0XVHRGH$UWH&RQWHPSRUiQHRGHOD8QL YHUVLGDGGH&KLOH0XVHR1DFLRQDO&HQWURGH$UWH 5HLQD6RItD 0DGULG 3HGUR0RQWHV\'3UR\HFWRV GH$UWH6DQWLDJRGH&KLOH5HG&RQFHSWXDOLVPRV del Sur y VAGA. MUSEO DE ARTE DE LIMA PRESIDENTE -XDQ&DUORV9HUPH DIRECCIÓN 1DWDOLD0DMOXI VICEPRESIDENTES 2VZDOGR6DQGRYDO Primer Vicepresidente 0DUtD-HV~V+XPH Segunda Vicepresidenta GERENCIA GENERAL )ODYLR&DOGD CURADURÍA DE COLECCIONES Y DE ARTE PRECOLOMBINO &HFLOLD3DUGR Asistente de gerencia y dirección &ODXGLD6iQFKH] REGISTRO Y CATALOGACIÓN 3LODU5tRV ADMINISTRACIÓN Pilar Quesada Asistente Colección permanente 5LFDUGR6DDYHGUD TESORERO 1LFROiV.HFVNHPHWK\ SECRETARIO Diego de la Torre VOCALES $UPDQGR$QGUDGHGH/XFLR Susana de la Puente Petrus Fernandini $OIRQVR*DUFtD0LUy (IUDtQ*ROGHQEHUJ -RVp&DUORV0DULiWHJXL &DUORV1HXKDXV 5D~O2WHUR Alberto Rebaza -DFTXHOLQH6DHWWRQH Manuel Velarde Asistente Marlene Hermoza Asistente Tienda &DUORV'tD] CONTABILIDAD 2UODQGR&DEHOOR Asistente Diana Mendoza RECURSOS HUMANOS Geraldine Núñez LOGÍSTICA Y MANTENIMIENTO 0HOED$ULFD Técnicos 3DEOR2UGRxH] $OHMDQGUR6iQFKH] 6LQGXOIR5HTXHMR Asistente Exposiciones temporales y obras en tránsito .DULQD$SDUFDQD CURADURÍA ASOCIADA DE ARTE COLONIAL Y REPUBLICANO 5LFDUGR.XVXQRNL CURADURÍA DE ARTE CONTEMPORÁNEO Sharon Lerner Asistente Valeria Quintana EXPOSICIONES Y PUBLICACIONES Jimena González Asistente .DURO+HUPR]D MUSEOGRAFÍA -XDQ&DUORV%XUJD Nelson Munares CONSERVACIÓN Y RESTAURACIÓN 0DUtD,QpV9HODUGH 0DUtD9LOODYLFHQFLR Asistente $QGUHD6DQ0DUWtQ Técnicos en restauración Simón Barraza 1DWLYLGDG(VSLQR &KULVWLDQ*RQ]iOH] Sara Jiménez $OHMDQGUR3XUL]DJD 3HUF\9HODVFR EDUCACIÓN DIRECTOR /XLV(QULTXH5DPtUH] Asistente 5XEt-DUD DIRECTORA DEL IESP $QJpOLFD9HJD Asistente .DULQD5RGUtJXH] Cursos y talleres 0DULHOOD&RUQHMR Informes &HOHVWH0DUtQ PROYECTOS EDUCATIVOS Rosario Rivadeneyra Asistente Gisella López -pVVLFD7LQHR PROYECCIÓN INTERNACIONAL 0DULD/XLVD0XxR]&RER BIBLIOTECA Jesús Varillas Asistente 3DROD7HMDGD IMAGEN Y MARKETING 9HUyQLFD7UHOOHV Comunicación y prensa Marilyn Lavado Diseño &DUOD5RGUtJXH] Eventos 1DWDO\5RGUtJXH] Programa amigos del museo /LJLD(VWDFLR MEDIOS DIGITALES Susy Sano AUDITORIO Jorge Alva Asistente de Auditorio Julio Beltrán -XDQ&DUORV9HUPH Museo de Arte de Lima Presidente (VWHOLEURHGLWDGRFRQRFDVLyQGHODPXHVWUDUn cuerpo ambulante. Sergio Zevallos en el Grupo Chaclacayo (1982-1994)FRQVWLWX\HXQGRFXPHQWR~QLFRTXHSODQWHDXQDPLUDGDUHWURVSHFWLYDDXQRGH ORVHSLVRGLRVPHQRVH[SORUDGRVGHQWURGHODKLVWRULRJUDItDGHODUWHSHUXDQRUHFLHQWH³HOWUDEDMRGHO *UXSR&KDFODFD\RDJUXSDFLyQFRQIRUPDGDSRUHODOHPiQ+HOPXW3VRWWD\ORVSHUXDQRV5D~O$YHOODQHGD \6HUJLR=HYDOORV³DWUDYpVGHODREUDLQGLYLGXDOGHXQRGHVXVLQWHJUDQWHV%DMRODLQYHVWLJDFLyQ\ FXUDGXUtDGH0LJXHO/ySH]HVWHHVIXHU]RHVWDPELpQSDUWHGHOWUDEDMRFROHFWLYRGHVDUUROODGRGHVGH SRUOD5HG&RQFHSWXDOLVPRVGHO6XUXQJUXSRGHLQYHVWLJDGRUHVWHyULFRV\DFWLYLVWDVTXHVHKD GHGLFDGRDSHQVDUFROHFWLYDPHQWHODVWUDQVIRUPDFLRQHVGHODVJUDPiWLFDVYLVXDOHV\GHORVPRGRVGH HQWHQGHU\KDFHUSROtWLFDHQ$PpULFD/DWLQDGHVGHORVDxRV(VWDSXEOLFDFLyQFRPSLODODREUDGH 6HUJLR=HYDOORVDWUDYpVGHXQH[KDXVWLYRSRUWDIROLRLOXVWUDGR\FRQWLHQHQXHYRVHQVD\RVGHOFXUDGRU 0LJXHO$/ySH]GHODVRFLyORJDFKLOHQDHLQYHVWLJDGRUDWHDWUDO)HUQDQGD&DUYDMDODVtFRPRGHOD ÀOyVRIDWHyULFD\DFWLYLVWDHVSDxROD%HDWUL]3UHFLDGR6HLQFOX\HDGHPiVXQDFRQYHUVDFLyQHQWUHORV DUWLVWDVSHUXDQRV$OIUHGR0iUTXH])ULGR0DUWLQ-DLPH+LJD\6HUJLR=HYDOORV\XQDQH[RGRFXPHQWDO TXHFRQWLHQHPDWHULDOHVLQpGLWRV (VVLJQLÀFDWLYRTXHHVWDH[KLELFLyQ\SXEOLFDFLyQVHKDJDQHQQXHVWURPXVHRLQVWLWXFLyQ TXHHQIXHVHGHGHODSULPHUD\~QLFDPXHVWUDGHO*UXSR&KDFODFD\RHQ/LPD(QHVHPRPHQWR HOSUR\HFWRJHQHUyJUDQSROpPLFDFHQVXUDVSDUFLDOHV\FRQGXMRDODHPLJUDFLyQGHÀQLWLYDGHORVDUWLVWDVLQYROXFUDGRVD$OHPDQLD+R\FDVLWUHLQWDDxRVGHVSXpVODVPLVPDVLPiJHQHVVLJXHQJHQHUDQGR UHVSXHVWDVHQFHQGLGDV(OHQIRTXHFXUDWRULDOGHUn cuerpo ambulanteSRQHPHQRVpQIDVLVHQHVH FDUiFWHUDE\HFWRGHODVLPiJHQHVHLQWHQWDPiVELHQXQDDSUR[LPDFLyQKLVWyULFDHQWRUQRDODUHLYLQ GLFDFLyQFUtWLFDGHOFXHUSRGHVGHXQDSRVWXUDDMHQDDODRÀFLDOLGDGDUWtVWLFDORFDOGHVXpSRFD$VtOD SUHVHQWDFLyQGHUn cuerpo ambulante le brinda al museo la oportunidad de repensar su propia histoULD\FRQWULEXLUDXQDUHÁH[LyQPiVDPSOLDDFHUFDGHODKLVWRULDFXOWXUDOSHUXDQD (QOtQHDVJHQHUDOHVODVH[SHULHQFLDVGHODFFLRQLVPRKDQWHQLGRHVFDVDGLIXVLyQHQQXHVWUR PHGLR(O*UXSR&KDFODFD\RHVVLQGXGDXQDGHHVDVLQVWDQFLDVRVFXUDVGHODKLVWRULRJUDItDORFDOTXH VLQHPEDUJROOHJyDDGTXLULUXQDXUDFDVLPtWLFDHQODHVFHQDODWLQRDPHULFDQDGHOD~OWLPDGpFDGD $XQTXHREUDVLQGLYLGXDOHVKDQVLGRUHVHxDGDVHQDOJXQDVDQWRORJtDV³\HOWUDEDMRGHO*UXSRKDVLGR PRWLYRGHDOJXQDVSRQHQFLDV³VHSXHGHGHFLUFRQFHUWH]DTXHHVWDHVODSULPHUDFRPSLODFLyQH[KDXVWLYDGHODVREUDVSURGXFLGDVSRUXQLQWHJUDQWHGHOJUXSR([LVWHQVLQGXGDRWURVDVSHFWRVHQODREUD GH&KDFODFD\RTXHPHUHFHQVHUH[SORUDGRV\HVSHUDPRVTXHHVWDSXEOLFDFLyQPRWLYHRWURVHVWXGLRV /DSUy[LPDSUHVHQWDFLyQGHODPXHVWUDHQOD.XQVWYHUHLQGH6WXWWJDUWSHUPLWLUiVLQGXGDDPSOLDUHO UDQJRGHODUHÁH[LyQVREUHHOWUDEDMRGH6HUJLR=HYDOORVHQFRQWH[WRVPiVDPSOLRVDOWLHPSRTXHQRV SHUPLWHFXPSOLUFRQODPLVLyQTXHQRVKHPRVLPSXHVWRGHFRQWULEXLUDODGLIXVLyQLQWHUQDFLRQDOGHO DUWHKHFKRHQHO3HU~ /DUHDOL]DFLyQGHHVWHSUR\HFWRKDVLJQLÀFDGRXQJUDQUHWRSDUDODLQVWLWXFLyQSRUHO FDUiFWHUHVSHFLDOPHQWHSROpPLFRGHODSURSXHVWD(VSRUHOORTXHHVWDPRVSDUWLFXODUPHQWHDJUDGH FLGRVDTXLHQHVQRVKDQDFRPSDxDGRHQHVWDLQLFLDWLYD)XHSDUWLFXODUPHQWHLPSRUWDQWHSRGHU FRPSDUWLUODH[SRVLFLyQFRQHO&HQWUR&XOWXUDOGH(VSDxDHQ/LPDTXHDFRJLyXQDSDUWHGHODPXHVWUD HQVXVVDODVJUDFLDVDOLQWHUpVGHVXGLUHFWRU-XDQ6iQFKH]6LODPXHVWUDSHUPLWLyPRVWUDUDOS~EOLFR ODREUDODSXEOLFDFLyQTXHDKRUDSUHVHQWDPRVSHUPLWLUiGRFXPHQWDUHVHWUDEDMRDIXWXUR(QHVH VHQWLGRKDVLGRIXQGDPHQWDOHODSR\RGHOD)RXQGDWLRQIRU$UWV,QLWLDWLYHV )I$, LQVWLWXFLyQTXHKD SDWURFLQDGRHVWDSXEOLFDFLyQFRQJUDQGHFLVLyQ\HQWXVLDVPR4XHUHPRVSRUHOORDJUDGHFHUPX\HVSHFLDOPHQWHD)UHG+HQU\SUHVLGHQWHGHODIXQGDFLyQDVtFRPRDWRGRVVXVGLUHFWRUHVSRUVXLQWHUpV HQHVWHSUR\HFWR)LQDOPHQWHQXHVWURDJUDGHFLPLHQWRD0LJXHO$/ySH]SRUKDEHUFRQÀDGRHQQRVRWURVODUHDOL]DFLyQGHXQSUR\HFWRTXHQRKXELHUDYLVWRODOX]VLQVXFRPSURPLVR\HQWXVLDVPR 7KLVERRNSXEOLVKHGVLPXOWDQHRXVO\ZLWKWKHH[KLELWLRQRI A Wandering Body: Sergio Zevallos in the Grupo Chaclacayo (1982-1994)LVDWUXO\XQLTXHGRFXPHQWRIIHULQJDORRN EDFNDWRQHRIWKHPRVWXQGHUH[SORUHGHSLVRGHVLQWKH KLVWRULRJUDSK\RIUHFHQW3HUXYLDQDUW³WKHZRUNRIWKH *UXSR&KDFODFD\RIRUPHGE\WKH*HUPDQDUWLVW+HOPXW Psotta and the Peruvians Raúl Avellaneda and Sergio =HYDOORV³WKURXJKWKHLQGLYLGXDOZRUNRIRQHRILWVPHPEHUV$LGHGE\WKHLQYHVWLJDWLRQDQGFXUDWRUVKLSRI0LJXHO /ySH]WKLVHIIRUWLVDOVRSDUWRIWKHFROOHFWLYHZRUNEHLQJ GRQHVLQFHE\WKH5HG&RQFHSWXDOLVPRVGHO6XU DJURXSRILQYHVWLJDWRUVWKHRUHWLFLDQVDQGDFWLYLVWVZKR KDYHGHGLFDWHGWKHPVHOYHVWRFROOHFWLYHO\WKLQNLQJWKURXJK WKHWUDQVIRUPDWLRQVRIYLVXDOJUDPPDUVDQGIRUPVRIXQGHUVWDQGLQJDQGHQJDJLQJLQSROLWLFVLQ/DWLQ$PHULFDVLQFH WKHV7KLVSXEOLFDWLRQEULQJVWRJHWKHUWKHZRUNRI 6HUJLR=HYDOORVWKURXJKDQH[KDXVWLYHLOOXVWUDWHGSRUWIROLR DQGLQFOXGHVQHZHVVD\VE\WKHFXUDWRU0LJXHO$/ySH] WKH&KLOHDQVRFLRORJLVWDQGWKHDWHULQYHVWLJDWRU)HUQDQGD &DUYDMDODQGWKH6SDQLVKSKLORVRSKHUWKHRUHWLFLDQDQG DFWLYLVW%HDWUL]3UHFLDGR,WDOVRIHDWXUHVDFRQYHUVDWLRQ EHWZHHQWKH3HUXYLDQDUWLVWV$OIUHGR0iUTXH])ULGR 0DUWLQ-DLPH+LJDDQG6HUJLR=HYDOORVDVZHOODVDGRFXPHQWDU\DQQH[FRQWDLQLQJQHYHUEHIRUHVHHQPDWHULDOV ,WLVÀWWLQJWKDWWKLVH[KLELWLRQDQGSXEOLFDWLRQDUH EHLQJIHDWXUHGLQRXUPXVHXPWKHYHU\VDPHLQVWLWXWLRQ WKDWVHUYHGDVWKHVLWHRIWKHÀUVWDQGRQO\H[KLELWLRQE\ WKH*UXSR&KDFODFD\RLQ/LPDEDFNLQ$WWKDWWLPH WKHSURMHFWSURYRNHGDJUHDWGHDORIFRQWURYHUV\DQGSDUWLDO FHQVRUVKLSOHDGLQJWRWKHSHUPDQHQWHPLJUDWLRQRIWKH DUWLVWVLQYROYHGWR*HUPDQ\1RZQHDUO\WKLUW\\HDUVODWHU WKHVDPHLPDJHVFRQWLQXHWRLQVSLUHÀHU\UHVSRQVHV 7KHFXUDWRULDOIRFXVRIA Wandering Body SODFHVOHVV HPSKDVLVRQWKHDEMHFWFKDUDFWHURIWKHLPDJHVLQVWHDG DWWHPSWLQJWRSURYLGHDKLVWRULFDODSSURDFKWRWKHFULWLFDO YLQGLFDWLRQRIWKHJURXSIURPDSRVLWLRQRXWVLGHWKHRIÀFLDO DUWLVWLFGRJPDLQIRUFHLQ/LPDDWWKDWWLPH7KXVWKH SUHVHQWDWLRQRIA Wandering Body gives the museum DFKDQFHWRUHWKLQNLWVRZQKLVWRU\DQGFRQWULEXWHWRD EURDGHUUHÁHFWLRQRQ3HUXYLDQFXOWXUDOKLVWRU\ *HQHUDOO\VSHDNLQJWKHH[SHULHQFHVRI$FWLRQLVP DUHUHODWLYHO\OLWWOHNQRZQLQ3HUX7KH*UXSR&KDFODFD\R LVZLWKRXWDGRXEWRQHRIWKRVHREVFXUHLQVWDQFHVLQRXU ORFDOKLVWRULRJUDSK\ZKLFKKDYHQHYHUWKHOHVVPDQDJHG WRWDNHRQDQDOPRVWP\WKLFDODXUDLQWKH/DWLQ$PHULFDQ VFHQHRYHUWKHODVWGHFDGH:KLOHLQGLYLGXDOZRUNVKDYH EHHQUHYLHZHGLQDKDQGIXORIDQWKRORJLHV³DQGWKHZRUN RIWKHJURXSKDVEHHQWKHVXEMHFWRIFRQIHUHQFHWDONV³ WKHUHLVQRTXHVWLRQWKDWWKLVLVWKHÀUVWH[KDXVWLYHFRP SLODWLRQRIWKHZRUNVSURGXFHGE\RQHRIWKH*URXS·VPHPEHUV7KHUHDUHFHUWDLQO\RWKHUDVSHFWVRI&KDFODFD\R·V ZRUNWKDWGHVHUYHWREHH[SORUHGDQGZHKRSHWKLVSXEOLFDWLRQUHVXOWVLQIXUWKHUVWXGLHV7KHXSFRPLQJH[KLELWLRQ DWWKH.XQVWYHUHLQLQ6WXWWJDUWZLOOGRXEWOHVVO\H[SDQGWKH UDQJHRIUHÁHFWLRQRQWKHZRUNRI6HUJLR=HYDOORVLQEURDGHU FRQWH[WVZKLOHDOVRHQDEOLQJXVWRIXOÀOORXUVHOILPSRVHG PLVVLRQRIFRQWULEXWLQJWRWKHLQWHUQDWLRQDOGLVVHPLQDWLRQ RIDUWPDGHLQ3HUX 7KHUHDOL]DWLRQRIWKLVSURMHFWKDVEHHQDPDMRU FKDOOHQJHIRUWKHLQVWLWXWLRQGXHWRWKHSDUWLFXODUO\FRQ WURYHUVLDOQDWXUHRIWKHSURSRVDO)RUWKLVUHDVRQZHDUH HVSHFLDOO\JUDWHIXOWRWKRVHZKRKDYHDFFRPSDQLHGXVLQ WKLVLQLWLDWLYH,WZDVSDUWLFXODUO\LPSRUWDQWWREHDEOHWR VKDUHWKLVH[KLELWLRQZLWKWKH6SDQLVK&XOWXUDO&HQWHULQ /LPDZKLFKGLVSOD\HGSDUWRIWKHZRUNVLQLWVH[KLELW KDOOVWKDQNVWRWKHLQWHUHVWRIWKH&HQWHU·VGLUHFWRU-XDQ 6iQFKH],IWKHH[KLELWLRQPDGHLWSRVVLEOHWRGLVSOD\WKH ZRUNWRWKHSXEOLFWKLVERRNZLOOPDNHLWSRVVLEOHWRGRFXPHQWWKDWZRUNLQWKHIXWXUH(VSHFLDOO\LPSRUWDQWLQWKLV VHQVHZDVWKHVXSSRUWRIWKH)RXQGDWLRQIRU$UWV,QLWLDWLYHV )I$, WKHLQVWLWXWLRQWKDWKDVVSRQVRUHGWKLVSXEOLFDWLRQ ZLWKJUHDWGHWHUPLQDWLRQDQGHQWKXVLDVP)RUWKDWUHDVRQ ZHZRXOGOLNHWRJLYHDVSHFLDOWKDQNVWR)UHG+HQU\WKH SUHVLGHQWRIWKHIRXQGDWLRQDVZHOODVDOORILWVGLUHFWRUV IRUWKHLULQWHUHVWLQWKLVSURMHFW)LQDOO\ZHZRXOGOLNHWR WKDQN0LJXHO$/ySH]IRUWUXVWLQJXVZLWKWKHUHDOL]DWLRQ RIDSURMHFWWKDWZRXOGQHYHUKDYHVHHQWKHOLJKWRIGD\ ZLWKRXWKLVFRPPLWPHQWDQGHQWKXVLDVP -XDQ&DUORV9HUPH Museo de Arte de Lima President 12 1 Exorcismos tóxicos. Sergio Zevallos en el Grupo Chaclacayo 1 Miguel A. López Toxic Exorcisms. Sergio Zevallos in the Grupo Chaclacayo 1 2 3 Fig. 2 Grupo Chaclacayo, La muerte obscena de un santo. Performance en Festival Flottmann-Hallen, Herne, Alemania, 1991. Archivo Sergio Zevallos. Fig. 4 Detalles de escultura realizada por Sergio Zevallos usada para La Procesión, Lima, 1982. Fotografía: César Guerra. Publicada en el artículo “Todo y/o Nada,” en Lima Kurier, Lima, n. 25 (julio de 1982), p. 3. Cortesía Goethe-Institut Lima. Fig. 1 Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin, Alexander Verlag, 1989). Portada. Biblioteca del Museo de Arte de Lima. Archivo de Arte Peruano. Fig. 3 Casa taller del Grupo Chaclacayo. En primer plano la serie Rosa-Paraphrasen (1986) de Helmut Psotta, y en el fondo la serie Letanías acalladas (1984-1988) de Raúl Avellaneda. Lima, ca. 1987. Fotografía: Raúl Avellaneda. Archivo Sergio Zevallos. Fig. 5 La Procesión, Lima, 1982. Fotografía: César Guerra. Archivo Sergio Zevallos. 4 5 Fig. 9 Los Bestias, Des-hechos en Arquitectura, 1984. Construcciones efímeras en la Universidad Ricardo Palma, Lima. Fotografía: Álex Ángeles. Cortesía Archivo Alfredo Márquez. Fig. 6 Sergio Zevallos en un paseo realizado a las orillas del río Chillón, Lima, 1980. Fotografía: Raúl Avellaneda. Archivo Sergio Zevallos. Fig. 8 Herbert Rodríguez, Alfredo Márquez y Alfredo Távara, Música Subterránea, Lima, 1985, publicación impresa en offset de matriz de cartón, 21 x 29 cm. Cortesía Archivo Herbert Rodríguez. Fig. 7 Estampita de Jesús Nazareno Cautivo de Monsefú intervenida con foto de Sergio Zevallos. Documentación de la investigación visual asociada a la serie Suburbios, Lima, 1982-1983. Archivo Sergio Zevallos. Fig. 11 Helmut J. Psotta (Grupo Chaclacayo), La agonía de un mito maligno, 1982. Participan: Sergio Zevallos, Raúl Avellaneda, Frido Martin. Fotografía: Piero Pereira. Imagen publicada en HODÀFKHGHODH[SRVLFLyQPerú… un sueño. (Lima: Museo de Arte de Lima-Goethe Institut, 1984). Archivo Sergio Zevallos. Fig. 10 Incineración de cadáveres en el Cementerio de Santa Eulalia, Lima, 1983-1984. Fotografía: Raúl $YHOODQHGD,PDJHQSXEOLFDGDHQHODÀFKHGH la exposición Perú… un sueño. (Lima: Museo de Arte de Lima-Goethe Institut, 1984). Archivo Sergio Zevallos. 6 7 Fig. 12 Gian Lorenzo Bernini, La transverberazione di santa Teresa d’Avila, 1647-1652. Publicado en Grupo Chaclacayo. Todesbilder: Peru oder Das Ende des europäischen Traums. (Berlin, Alexander Verlag, 1989), p. 42. Fig. 13 Portada del cómic Rubí. Lágrimas, risas y amor, Bogotá, n. 13. Documentación de la investigación visual asociada a la serie Suburbios, Lima, ca. 1983-1984. Fig. 16 Estampa popular de la Beatita de Humay. Archivo Sergio Zevallos. Fig. 17 Sergio Zevallos (Grupo Chaclacayo), de la serie Símbolos - Huellas de un crimen, 1985-1986. *UDÀWRVREUHSDSHO[FP Fig. 15 Sergio Zevallos (Grupo Chaclacayo), de la serie Sangre y Ceniza. Variaciones sobre la bandera, *UDÀWRWpPSHUDSDVWHO\OiSL]GHFRORU sobre papel, 58.5 x 43 cm. Fig. 14 Domingo, suplemento de La República, Lima, 5 de junio de 1986, p. 20. Fig. 19 Sergio Zevallos (Grupo Chaclacayo), de la serie Celdas, 1985-1987. Copia a la plata sobre papel baritado. 50 x 37 cm. Fig. 18 Cuerpo encontrado en la fosa común de Pucayacu. La República, Lima, 25 de agosto de 1984, p. 16. Fotografía: Julio Pérez. 8 1 Parte inicial de esta investigación fue realizada en colaboración con Emilio Tarazona entre 2008 y 2011. Para una versión preliminar de este texto véase Miguel A. López, “Queer Corpses: Grupo Chaclacayo and the Image of Death”, en E-Flux 44 (Im) practical (Im)possibilities (Carlos Motta, ed.), abril de 2013, http:// ZZZHÁX[FRPMRXUQDOTXHHU corpses-grupo-chaclacayo-andthe-image-of-death/ 2 Este libro compila varios de los textos históricos más importantes sobre el grupo publicados en Perú y Alemania entre 1982 y 1991. En la última década ha sido el crítico Emilio Tarazona quien ha ensayado importantes acercamientos sobre el trabajo del Grupo Chaclacayo –para una referencia sobre sus escritos véase la bibliografía en este libro. Desde la perspectiva de la sexualidad y el género, el artista y docente Miguel García ha analizado el trabajo de travestismo de Zevallos como un episodio pionero de prácticas artísticas maricas en Perú. Véase Miguel García, “Auténticos, Destructores, Forajidos y Amorosos: Políticas corporales y nuevas estéticas en una ciudad interminable,” en Jorge Bracamonte, ed. De amores y luchas: diversidad sexual, derechos humanos y ciudadanía (Lima, Centro de la Mujer Peruana Flora Tristán, 2001), pp. 231-252. 3 Ver el temprano comentario del crítico Luis Lama, “Pobre Goethe,” en Caretas, Lima, 3 de diciembre de 1984, p. 63. Este y otros artículos de Lama se comentan en este escrito. Más recientemente el crítico Manuel Munive utiliza la fuerte presencia de lo sexual para desestimar el trabajo de Zevallos –y del Grupo Chaclacayo en general– al señalar que su obra transita por el “trillado camino del onanismo estético.” Véase Manuel Munive, “Inkarri. Vestigio barroco,” Illapa. Revista del Instituto de Investigaciones Museológicas y Artísticas de la Universidad Ricardo Palma, año 2, n. 2, (Lima, diciembre de 2005), pp. 127-128. El trabajo de disidencia sexual profundamente transgresivo del Grupo Chaclacayo ha sido hasta hoy un episodio poco investigado. Desde los años 80, los relatos sobre el colectivo han circulado como un mito o un rumor debido, por un lado, a la escasa documentación existente sobre su trabajo, y por otro, al exilio de sus integrantes quienes dejaron el Perú para vivir en Alemania en 1989.2 Las historias del grupo también han sido parcialmente conocidas a través de murmuraciones suscitadas por polémicas que su obra despertó. Incluso un sector conservador de la crítica ha intentado ridiculizar la manera en que el grupo abordó la violencia política desde una abyección perturbadora que intersectaba la decadencia del militarismo, la teatralidad religiosa y una sexualidad exacerbada en una sociedad machista, misógina y homofóbica.3 La inadecuación de sus prácticas frente a los modelos viriles de las disciplinas artísticas tradicionales (pintura y escultura), su distancia con la escena cultural limeña, así como su desajuste en relación con el tradicional repertorio crítico de la izquierda, hicieron que el trabajo del grupo se convierta en una experiencia en alguna medida ininteligible para la crítica cultural. Experiencia además olvidaGDSRFRGHVSXpVSRUODGLÀFXOWDGGHDFFHGHUDWHVWLPRQLRV\GRFXPHQWRVSURGXFLGRVHQDTXHOORVDxRV Esta situación relegó la posibilidad de afectar (de infectar) la historia del arte local, pero sobre todo de incorporar aquel episodio a una genealogía mayor de luchas sociales y prácticas de desobediencia de género en donde la blasfemia y la orgía han sido formas poderosas de crítica al poder colonial, militar, racial, religioso, de clase, y heteronormativo. Una tradición que nos puede llevar desde las eyaculaciones sobre el cáliz realizadas por el Marqués de Sade en el siglo XVIII, hasta las teatralizaciones litúrgiFDVFRQSURVWLWXWDV\WUDYHVWLVGHOG~R<HJXDVGHO$SRFDOLSVLVDOÀQDOGHODGLFWDGXUDPLOLWDUHQ&KLOH El trabajo del Grupo Chaclacayo, realizado entre Perú y Alemania, fue un proyecto de convivencia sexual y afectiva que duró aproximadamente doce años (1982-1994). El grupo surgió a inicios de los años 80 en el Perú, en medio de una violenta guerra entre la organización subversiva maoísta Sendero Luminoso y el Estado Peruano. Aunque estuvo principalmente conformado por tres artistas –el alemán Helmut Psotta (Ruhrgebiet 1937 - †2012), y los peruanos Raúl Avellaneda (Lima, 1960) y Sergio Zevallos (Lima, 1962)–, el grupo contó con la colaboración de diversos amigos a lo largo del tiempo. Psotta, Avellaneda y Zevallos se autoexiliaron en una pequeña casa-taller en el distrito de Chaclacayo, en las afueras de Lima, donde vivieron por más de seis años desde 1982. El grupo tuvo una sola exposición en el Museo de Arte de Lima en noviembre de 1984, luego de lo cual siguieron produciendo dibujos, esculturas y fotografías que nunca se exhibieron en Perú. Durante esos años, el grupo sobrevivió de forma modesta gracias a los aportes económicos personales de Helmut Psotta, quien tuvo que viajar en más de una oportunidad a Alemania para conseguir recursos. En enero de 1989 decidieron dejar el país y se desplazaron a Alemania forzados por la escasez de recursos económicos \ODFUHFLHQWHKRVWLOLGDGVRFLDOGHXQWHUULWRULRVXPLGRHQXQFRQÁLFWRDUPDGRTXHGHMDUtDXQVDOGRGH 70 mil muertos en casi dos décadas (1980-2000).4 Los artistas llevaron consigo todas las obras producidas en Lima, y aquello que no pudieron transportar a Europa lo incineraron, llevando las cenizas en un pequeño recipiente. 9 (OFRQÁLFWRDUPDGRHQHO3HU~ terminó en 2000 con la caída del dictador Alberto Fujimori y su gobierno criminal y corrupto. Los principales actores en la guerra fueron la organización maoísta Sendero Luminoso, la guerrilla Movimiento Revolucionario Túpac Amaru, y el gobierno peruano. Todos los actores armaGRVHQHOFRQÁLFWRFRPHWLHURQYLRODciones sistemáticas contra los derechos humanos y mataron civiles. 5 La exposición se presentó entre 1989 y 1991 gracias al Institut für Auslandsbeziehungen (ifa) en Stuttgart (19 de abril – 18 de junio, 1989), el Museo Bochum (15 de julio – 27 de agosto, 1989), el Badischer Kunstverein en Karlsruhe (21 de septiembre – 29 de octubre, 1989), y el Künstlerhaus Bethanien en Berlín (19 de enero – 18 de febrero, 1990), y también en dos escenarios en el lado perteneciente a la DDR: la Galerie am Weidendamm del Zentrum für Kunstausstellungen (9 – 27 de mayo, 1990) y en el Maxim Gorki Theater, donde el grupo presentó una serie de performances en vivo. Además, en el vestíbulo del teatro Maxim Gorki el grupo exKLELyXQDUHWURVSHFWLYDIRWRJUiÀFD de varias de sus acciones que fue rápidamente censurada. 6 Su última presentación como grupo fue en Fest III (29 de setiembre — 3 de octubre, 1994) en Dresden. En este festival participaron también el grupo esloveno Laibach, la compañía de danza Betontanc, el cineasta Lutz Dammbeck, el artista y teórico Peter Weibel, entre otros. Luego de llegar a Alemania, pocos meses antes de la caída del Muro de Berlín, el Grupo Chaclacayo presentó una exposición que sintetiza su trabajo titulada Todesbilder. Peru oder Das Ende des europäischen Traums ,PiJHQHVGHOD0XHUWH3HU~RHOÀQDOGHOVXHxRHXURSHR ODFXDOIXH H[KLELGDHQPXVHRVHLQVWLWXFLRQHVHQ6WXWWJDUW%RFKXP.DUOVUXKH\%HUOtQ>ÀJ@5 Como parte de la exposición el grupo desarrolló una serie de performances en vivo, cuyo eje giraba fundamentalmente HQWRUQRDWHPDVFRPRODWRUWXUD\ODREVFHQLGDG/DVSHUIRUPDQFHVUHDOL]DGDVVLQJXLyQSUHGHÀQLGR mezclaban música de Bach, Mozart y Schubert, imágenes de cantantes populares fascistas, textos de Goethe y Rilke, peluches, globos y maniquíes, himnos y marchas militares, personajes de cuentos infantiles alemanes, poesías religiosas de Santa Teresa de Ávila, entre otros elementos. Con un lenguaje ritual y agresivo el grupo conectó la herencia del colonialismo en América Latina, la derrota de las guerrillas izquierdistas en manos de las dictaduras militares en el Cono Sur, la guerra popular maoísta en HO3HU~FRQODFDtGDGHOFRPXQLVPRHQ(XURSD\ODUHXQLÀFDFLyQDOHPDQD/XHJRGHDOJXQDVSUHVHQ taciones adicionales, el grupo terminó por disolverse aproximadamente en 1995.6 Los límites de la experiencia del Grupo Chaclacayo son imprecisos porque su composición respondió a las relaciones íntimas entre sus integrantes. En Lima, los artistas vivieron apartados de la escena cultural, aunque invitando de forma esporádica a diversos críticos y artistas a visitar el taller. También los acompañaron amigos que llegaron a convivir con ellos y participaron de las acciones y fotografías, lo que daba como resultado cambios temporales en la conformación afectiva y de trabajo del grupo. En todos esos años sus participantes externos más importantes fueron Jorge Ángeles, el artesano y joyero Sixto Paniora, el poeta Frido Martin, y el artista alemán Klaus Wittkamp, y en los dos primeros años contaron con el apoyo de los fotógrafos César Guerra y Piero Pereira. La obra del grupo fue una reelaboración explosiva de los residuos de la ciudad, fusionando representaciones del dolor místico y el martirio religioso con las miles de imágenes de cuerpos torturados \GHVSHGD]DGRVSURGXFWRGHODYLROHQFLD\HOFRQÁLFWRDUPDGRLQWHUQR>ÀJ@(OWHUURUHLQFRPSUHQsión, así como la fascinación y seducción que en esos años despertó su mística en aquellos que los FRQRFLHURQIXHFRQVHFXHQFLDGHODRVFXULGDGGHVXWUDEDMRSREUHV\DQWLJODPRURVDVHVFHQLÀFDFLRQHV GHOGRJPDWLVPRLGHROyJLFRUHSUHVHQWDFLRQHVKRPRHUyWLFDVHQWUHHOVDFULÀFLR\ODQHFURÀOLDUHVLJQLÀcaciones travestis del poder militar, alegorías de sexualidades sodomitas y penitentes, acciones que HPSOHDEDQDWD~GHV\UHVWRVGHFDGiYHUHVDVtFRPRDOXVLRQHVDIHWRVUHVLGXRVKXPDQRV\ÁXLGRV >ÀJ@(QVXVREUDVORVFXHUSRVDSDUHFHQVLHPSUHHQH[WUDxDVPHWDPRUIRVLVFXHUSRVDQGUyJLQRV que devienen cuerpos mutilados, victimarios que son también víctimas, cuerpos que dan a luz y que terminan destruidos. Su trabajo fue un experimento de producción de subjetividades desviadas que GHVDÀDEDQODVFDWHJRUtDVVRFLDOHVH[LVWHQWHV 7 El artista alemán tenía ya una larga experiencia dictando seminarios y conferencias en la Rijksakademie van Beeldende Kunsten en Amsterdam, la Academia Jan van Eyck y la Academia de Bellas Artes de Maastricht, la Academia de Diseño AIVE en Eindhoven, la AcadePLDGH$UWH¶0LQHUYD·\HO,QVWLWXWR Ubbo Emmius Groningen, así como las facultades de diseño de Bielefeld y Düsseldorf, entre otras. Antes de ello, en los años 60, Psotta había participado en la fundación y dirección del Instituto de Diseño de la Facultad de Arquitectura de la PontiÀFLD8QLYHUVLGDG&DWyOLFDGH&KLOH\ es en esa ciudad donde conoce al vitralista austriaco Adolfo Winternitz, 10 El retiro La formación del grupo fue consecuencia del alejamiento de los tres artistas de la Escuela de Arte de la Universidad Católica del Perú, donde Helmut Psotta había llegado en marzo de 1982 como profesor invitado desde Europa.7 A Psotta se le encargó dictar una serie de cursos de composición y diseño para los alumnos de primer y segundo año, además de otras presentaciones y seminarios en donde conoció a los entonces estudiantes Avellaneda y Zevallos. En uno de estos cursos abiertos Psotta propuso trabaMDUHOWHPDGHODWRUWXUDFRQODLQWHQFLyQGHGHVDÀDUORVSDUiPHWURVFRQVHUYDGRUHVGHODXQLYHUVLGDG\ solicitó a los alumnos compilar imágenes de prensa sobre violencia y muerte para trabajar en clase. El seminario no solo produjo reacciones hostiles en algunos alumnos sino también en las autoridades GHOD(VFXHODGH$UWHTXHHPSH]DURQDYHUFRQGHVFRQÀDQ]DVXWUDEDMR 8QDGHODVDFFLRQHVPiVVLJQLÀFDWLYDVUHDOL]DGDVSRUHVWHJUXSR²DQWHVGHFRQVWLWXLUVH RÀFLDOPHQWHFRPR¶FROHFWLYR·²HVXQDSURFHVLyQSUHVLGLGDSRUXQDOWDUGHLPiJHQHVEODVIHPDVKHFKDV con basura y materiales encontrados, el cual incluía además dos retratos colgantes: la imagen del dicWDGRUFKLOHQR$XJXVWR3LQRFKHW\HOUHWUDWRGH6DQWD5RVDGH/LPD>ÀJ@(OWyWHPSURGXFLGRSRU Sergio Zevallos, era claramente inadecuado para los valores estéticos de la academia, pero más insoportable aún era el acto de llevar el objeto en andas por los pasillos de la universidad para luego sacarlo a la calle y pasearlo por los distritos aledaños hasta la casa de los padres del artista. En la procesión participaron también el poeta Frido Martin –quien luego colabora con Zevallos en varias series de fotografías–, y el artista Fernando Bryce, quien tocaba un tambor de lata, encabezando aquella comSDUVDTXHSDURGLDED\GHVQDWXUDOL]DEDXQPXOWLWXGLQDULRULWRFDWyOLFR>ÀJ@8 Durante esos meses, Psotta fue hostigado hasta que decidió alejarse de la universidad, mudándose junto con Zevallos y Avellaneda a una casa ubicada en el distrito de Chaclacayo, en la periferia de Lima, en un intento de tomar distancia del sistema del arte, de sus circuitos económicos y sus modelos tradicionales de buen gusto. La colaboración entre Zevallos y Avellaneda comenzó mucho antes de la llegada de Psotta a Lima. Ambos establecieron una relación afectiva hacia 1980 –poco después del ingreso de Zevallos a la universidad– y realizaron juntos una serie de acciones de travestismo espontáneo. En 1980, en un viaje a Canta (al noreste de Lima, cerca de los Andes), Zevallos realizó un autorretrato desnudo y travestido en la orilla del río Chillón, en la cual representa a un personaje con un bastón de madera y una SHOXFDEODQFDHQDOXVLyQDXQOLEHUWLQRGHODpSRFDEDUURFD>ÀJ@/DIRWRJUDItDUHDOL]DGDFRQOD ayuda de Avellaneda, remedaba la teatralidad y la sensualidad de las representaciones católicas FRURQDVÁRUHVURVWURVPDTXLOODGRV\H[SUHVLRQHVGHp[WDVLV >ÀJ@ORFXDOHVWDPELpQXQSUHOXGLR de otros autorretratos que Zevallos realizó en 1984, como la serie Martirios inspirada en la imagen de la Mater Dolorosa. En 1982, con la llegada de Psotta a la universidad, los tres iniciaron una relación emocional y sexual profundamente intensa que les permitió establecer un diálogo en torno a temas de FRP~QLQWHUpVFRPRODUHOLJLyQODVH[XDOLGDG\ODSROtWLFDORVFXDOHVÀQDOPHQWHVHFRQYLUWLHURQHQHO centro de su vinculación creativa. entonces director de la Escuela de Arte de la Universidad Católica del Perú, quien lo invitó varios años después como profesor a esta institución. (Conversaciones con Helmut Psotta, Galhen y Berlín, 2009-2010). 11 8 Tanto Bryce como Martin hicieron también otro tipo de incursiones lúdicas en espacios públicos, en marchas y movilizaciones. Fernando Bryce tocaba entonces la batería en el grupo Durazno Sangrando, junto al poeta Rodrigo Quijano y Octavio Susti. Este grupo era cercano al colectivo de poesía Kloaka (1982-1984), donde Frido Martin también participaba como invitado. Véase Roger Santivañez, “Música joven: Entre la chicha y el rock,” Revista de la Semana, suplemento de El Observador, n. 18 (Lima, 3 de abril de 1983). 9 Sobre la escena subte véase Carlos Torres Rotondo, Se acabó el show. 1985. El estallido del rock subterráneo (Lima, Editorial MutanWH \6KDQH¶*DQJ·*UHHQH “Notes on the Peruvian Underground: Part II,” Maximum Rocknroll, San Francisco, n. 356 (January 2013). 10 En 1983, una sucesión de asesinatos a gran escala despertó la preocupación sobre la violencia a nivel nacional: la masacre de Uchuraccay, en la que ocho periodistas fueron asesinados por una comunidad andina con entrenamiento militar al confundirlos con integrantes de Sendero Luminoso; la matanza de Lucanamarca, en la cual sesenta y nueve campesinos fueron asesinados por Sendero Luminoso; la matanza de Soccos, con un saldo de treinta y dos campesinos eliminados por la Guardia Civil, entre otras. El Informe Final de la Comisión de la Verdad y Reconciliación (CVR) ha señalado que 1983 y 1984 fueron los años más IHURFHVGHWRGRHOFRQÁLFWRDUPDGR (1980-2000), perdiendo la vida un tercio de las víctimas de todo el periodo de violencia. Veáse: Comisión de la Verdad y Reconciliación, Informe Final, 2003, vol. 1, capítulo 3. (VWDVLPiJHQHVWHPSUDQDVDQXQFLDURQODVJUDPiWLFDVIXHUWHPHQWHHVFHQRJUiÀFDVGHO Grupo Chaclacayo. El colectivo se caracterizó por usar símbolos asociados al fanatismo, la religión y las ideologías: mitras papales que se convierten en capirotes del Ku Klux Klan y cruces cristianas que se transforman en esvásticas nazis, como parientes perdidos de una misma genealogía totalitaria. El Grupo Chaclacayo desplegó una aterradora teatralidad de la destrucción que hizo visible los efectos sociales y políticos de la colonización europea, la ocupación militar y la cruzada evangelizadora religiosa del siglo XVI, produciendo una serie de representaciones gozosamente obscenas. Sus imágenes intentaron vincular el pasado y el presente, la fastuosidad y la miseria, el erotismo y la brutalidad, como un comentario exasperado sobre la continuidad de la violencia colonial. Esa casa, entre 1982 y 1989, sería así el lugar para ensayar nuevos estados de libertad, dando vida a una iconografía sexual proIDQDTXHUHVLJQLÀFDHOSDLVDMHGHWHUURUPXHUWH\H[WHUPLQLRGLIXQGLGRSRUORVPHGLRVGHSUHQVD diariamente. Microgrupos La formación del Grupo Chaclacayo ocurrió en simultáneo al estallido de una escena contracultural sin SUHFHGHQWHVTXHVHGHVDUUROOyHQ/LPDGHVGHODSULPHUDPLWDGGHORVDxRVFRQRFLGDFRPROD¶PRYLGD VXEWHUUiQHD·(VWDPRYLGDDQDUTXLVWD\UHYXOVLYDGHPLFURFRPXQLGDGHVGHSURGXFFLyQFUHDWLYDamateur WXYRFRPRVXVSULQFLSDOHVFDQDOHVGHFRPXQLFDFLyQODSRHVtDODVDUWHVYLVXDOHVODÀORVRItD\ODP~VLFD –rock, punk y hardcore inicialmente, fusionados en algunos casos con la chicha, ritmos tropicales, entre otros. Así, grupos de rock como Leuzemia, Narcosis, Zcuela Cerrada, Guerrilla Urbana, Autopsia; publicaciones y prensa musical alternativa como Macho Cabrío, Alternativa Subterránea, Luz Negra; el trabajo de arquitectura participativa y creación de plataformas de encuentro colectivo organizado por el grupo Los Bestias (1984-1987); las escenografías subte\ODSURGXFFLyQJUiÀFDGH+HUEHUW5RGUtJXH] Alfredo Márquez, Jaime Higa, entre muchos otros; dieron forma a un momento efervescente de producción cultural autogestionada emparentada por la crudeza de sus lenguajes y la negación total de ORVYDORUHVRÀFLDOHV>ÀJ@9 El caos, la violencia y la crisis social que estas experiencias pusieron de relieve de forma intuitiva en sus canciones, poemas e imágenes, tradujeron de una manera genuina el estado de ánimo de toda una generación cansada de las estructuras de la política tradicional. Hacia ÀQHVGHORVDxRVODUDGLFDOL]DFLyQGHODHVFHQD¶VXEWH·ODFRQYLUWLHURQHQXQEODQFRGLUHFWRGHORV ataques y la represión que terminó por fragmentarla y disolverla a inicios de los años 90. Los momentos iniciales del Grupo Chaclacayo, así como de algunas otras experiencias UDGLFDOHVSUy[LPDVDOR¶VXEWH·FRPRHO0RYLPLHQWR.ORDND  GHSRHVtDFRLQFLGLHURQFRQ algunos de los episodios políticos más atroces de asesinato y masacre en los Andes centrales perpetrados por las fuerzas armadas y por Sendero Luminoso entre 1983 y 1984.10 Si bien el Grupo &KDFODFD\RQRHVWDEOHFLyUHODFLyQGLUHFWDFRQORVSURWDJRQLVWDVGHODPRYLGD¶VXEWH·²WDQVRORFRQ Frido Martin, allegado al Movimiento Kloaka–, ambas experiencias fueron cercanas por colocar al 12 11 Lama, “Pobre Goethe,” p. 63. 13 12 Conversaciones con Sergio Zevallos. Lima, noviembre de 2013. 13 Boris Groys, “La condición poscomunista” (traducción de Desiderio Navarro), Criterios, 2007, http:// www.criterios.es/pdf/mondediplogroyscondicion.pdf en Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin, Alexander Verlag, 1989). Véase el texto original en español publicado en este volumen en las páginas 117-118. 14 Sobre ello véase Luis Sánchez-Mellado, “La sexualidad es como las lenguas. Todos podemos aprender varias. Entrevista: Beatriz Preciado,” El País, Madrid, 13 de junio de 2010. 15 Sergio Zevallos, “Der Obszöne 7RG3HUX(LQHÀQVWHUH Gebärmutter für meine Bilder,” FXHUSRFRPRHOSURWDJRQLVWDFHQWUDOGHVXVHQXQFLDGRV5HVXOWDVLJQLÀFDWLYRTXHHQXQDGHODVIRWRgrafías de la exposición del grupo en 1984 aparezca Alfredo Márquez –uno de los protagonistas más DFWLYRVGHODHVFHQD¶VXEWH·²\DOJXQRVLQWHJUDQWHVGHOFROHFWLYR/RV%HVWLDVHQWRUQRDXQDGHODVSUHFDULDVHVFXOWXUDVHQWRQFHVH[KLELGDV>ÀJ@$~QFXDQGRQROOHJDURQDWUDEDMDUMXQWRVDPEDVH[SHriencias (el Grupo Chaclacayo y el colectivo de arquitectura Los Bestias) son probablemente los proyectos de experimentación creativa más radicales en aquellos años: emparentados no solo por la reVLJQLÀFDFLyQGHORVHVFRPEURVVLQRVREUHWRGRSRUODFODULGDGFRQTXHDPERVDVXPHQFyPRODFRQVWUXFFLyQGHDUTXLWHFWXUD\HVFHQRJUDItDVSXHGHPRGLÀFDUHOFRPSRUWDPLHQWRGHORVFXHUSRV\DVtLQtervenir en la producción de subjetividad de una colectividad. Al igual que una parte de la escena ¶VXEWH·GHVGHHO*UXSR&KDFODFD\RUHVSRQGLyFUtWLFDPHQWHDODVPLOHVGHLPiJHQHVGH muerte y exterminio que empezaron a circular en la prensa en un contexto donde la destrucción no era solamente una posibilidad creativa sino una realidad social inminente. Resulta revelador observar una de las principales reacciones de la crítica de arte local frente a la exposición del grupo en el Museo de Arte de Lima en 1984. En la revista Caretas, Luis Lama GHQXQFLDORVH[FHVRVHVWpWLFRV\ODLQFRUUHFFLyQSROtWLFDGHHVWDVREUDV\FXHUSRVFDOLÀFDQGRH[DVSHradamente las obras como una “nula tergiversación seudoartística”, una “alegoría de la decadencia”, una “parafernalia de la blasfemia”, una “vivisección de la degeneración”, un “mito homosexual” y una “desmesurada búsqueda de patetismo”. El crítico cancela la posibilidad de un debate artístico de estas LPiJHQHVSDUDGHVWHUUDUODVDOHVFUXWLQLRFOtQLFR\VLFROyJLFRFDOLÀFiQGRODVFRPR´SHUYHUVLRQHVTXHHVWiQ más cerca de Lacan que de Marx.”11 La indignación que despierta en Lama la presencia de estos cuerSRVGHVYLDGRVHVXQVtQWRPDWHPSUDQRGHODDPHQD]DTXHHVWDVJUDPiWLFDVPDULFDVVLJQLÀFDQSDUDOD continuidad del orden social nacional heterosexual, y más peligrosas aún al ocupar un museo reservado para el arte moderno de las élites –preferiblemente masculino, blanco, limpio y disciplinado. El título de la exposición elegido por el grupo, Perú… un sueño, era una alusión a la representación exotizante que se suele hacer de ciertos territorios desde la mirada turística eurocéntriFD,QVSLUDGRVHQXQDSLH]DJUiÀFDGHODUWLVWDFKLOHQR&DUORV/HSSHHOJUXSRGHFLGLySURGXFLUHODÀFKH de la exposición como imitación paródica de los folletos de propaganda, reemplazando las imágenes GHOD¶WLHUUDSURPHWLGD·SRUUHJLVWURVGHFiUFHOHVWRUWXUDV\HQWLHUURV(O3HU~HUDPRVWUDGRDVtFRPR un efecto invertido de las fantasías imperiales e ideales europeos modernos aplicados en el mundo no HXURSHR>ÀJ@12 Las obras en la exposición y el título intentaban señalar cómo los procesos coloniales de modernización en gran parte de América Latina –y en otros lugares del llamado Tercer Mundo– han estado estrechamente asociados al totalitarismo de ideas como civilización, evangelización y occidentalización. Pero Perú… un sueñoSXHGHVHUKR\WDPELpQXQDSXHVWDHQHYLGHQFLDGHODÀFFLyQGHO(Vtado-Nación y de sus violentas demandas de pertenencia identitaria. Más aún, en un momento donde la caída del comunismo como proyecto político internacionalista (1989) y la desaparición de otros moGHORVVRFLDOHVSRVQDFLRQDOHVKDQQDWXUDOL]DGRODDUWLÀFLDOLGDGGHORV(VWDGR1DFLyQDOSXQWRGHKDEHU- los convertido en los “protagonistas reales de la historia”.13/DGLÀFXOWDGGHLPDJLQDUKR\PRGHORV\ sistemas sociales que se desentiendan de la idea de nación continúa limitando la capacidad de dar forma a pueblos producidos y unidos por proyectos políticos comunes, uno de los cuales es aquella multitud desobediente de cuerpos sexuales desclasados –andróginos, travestis, transgéneros, intersexuales, prostitutas, desadaptados, promiscuos–, y toda una serie de cuerpos enfermos, discapacitados y tullidos que comparten una historia común de patologización, los cuales son invocados directa o indirectamente en las gramáticas visuales y acciones del grupo. Estas micro-colectividades nómades están ensayando desde hace mucho modos estratégicos de contestación cultural y producción económica que escapan a la fantasía de vigilancia y control total del Estado, y de las cuales es necesario aprender: formas alternativas de relación personal y política que apuestan por lo no familiar, por lo no nacional, por lo no generizado.14 Yo soy la esposa de Cristo 6HUJLR=HYDOORVLQWURGXFHODUHÁH[LyQVREUH6DQWD5RVDDO*UXSR&KDFODFD\RHQVXVFROODJHV\ dibujos, iniciados poco antes de su salida de la universidad, intervienen violentamente la memoria VRFLDO\UHOLJLRVDGHODSULPHUD6DQWDGH$PpULFDEHDWLÀFDGDHQHOVLJOR;9,,\WDPELpQFRQRFLGDFRPR OD¶HVSRVDGH&ULVWR·(QODVHULHEstampas  =HYDOORVPRGLÀFDGHIRUPDREVFHQDYDULRVUHWUDWRV históricos de Santa Rosa, embistiendo los discursos religiosos de sometimiento y profanando la imagen mística hasta convertirla en un paisaje sadomasoquista de fantasías incestuosas y homoeróticas. Los collages y dibujos de Zevallos revierten el autoritarismo racial y sexual que la memoria viva de la colonización ejerce sobre los cuerpos, poniendo en escena una representación de Santa Rosa HQJXHUUDGRQGHHO¶EODQTXHDPLHQWR·KLVWyULFRGHVXLPDJHQSURGXFWRGHVXFDQRQL]DFLyQHVFRQIURQtado por los deseos sexuales reprimidos y sus orígenes mestizos. En otras dos series de esa época, tituladas Rosas (1982) y Que tu carne es el cielo recién nacido  =HYDOORVSUHVHQWDYDULDFLRQHVJUiÀFDVKHFKDVFRQFDUEyQ\WL]DGHFRORUWDPELpQHQ WRUQRDODLPDJHQGH6DQWD5RVD(QHVWRVGLEXMRVH[WUHPLGDGHVGHFXHUSRVRULÀFLRVOODJDVÁXLGRV y heridas, construyen aglomeraciones orgiásticas de placer y dolor, de vida y de muerte. Las imágenes son el resultado de una repetición obsesiva que hurga en lo salvaje, introduciéndonos en una colorida y festiva pesadilla de aniquilamiento. Según Zevallos, estos y otros dibujos de esos años (como la serie Altares de 1985 y Sangre y Ceniza de 1987) buscaban hacer colisionar mitos religiosos con “el culto GHORVKpURHVQDFLRQDOHVHO7ULEXQDOGHO6DQWR2ÀFLRGHOD,QTXLVLFLyQFRQVXHTXLYDOHQWHDFWXDOODLQVWLWXFLyQGHWRUWXUDHQORVLQWHUURJDWRULRVSROLFLDOHV>\@ODVGHIRUPDFLRQHVXUEDQDVGHODQWLJXRIXQHUDO DQGLQRFRQORVHQWLHUURVFODQGHVWLQRV\WUiÀFRGHYtFWLPDVGHOSRGHUSROtWLFRµ15 Otra serie notable de dibujos inspirados en la imagen de la Santa es Rosa Paraphrasen (1986), en la que Psotta superpone el retrato de su madre –también llamada Rosa- y la representación de Santa Rosa, construyendo un repertorio de imágenes siniestras de dolor, desolación y angustia. 14 16 Helmut Psotta, “Die Koloniale Jesusbraut Rosa von Lima und die Korruption der weißen Kaste oder Eine lyrische Version europäischer Brutalität...,” en Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin, Alexander Verlag, 1989), pp. 39-49. 17 Dorothee Hackenberg, “Dieser Brutälitat der Sanftheit. Interview mit Helmut J. Psotta, Raúl Avellaneda, Sergio Zevallos von der Grupo ChaFODFD\REHU¶7RGHVELOGHU·µtaz, Berlín, 26 de enero de 1990, p. 22. Véase la traducción de esta entrevista en este libro en las páginas 124(QXQWH[WRGHHOÀOyVRIR alemán Walter Benjamin observa el capitalismo como un “fenómeno religioso” cuyo desarrollo fue reforzado de forma decisiva por el cristianismo: “El capitalismo es una religión que consiste en el mero culto, sin dogma. El capitalismo en sí mismo se ha desarrollado en Occidente –no solo en el calvinismo sino también en el resto de orientaciones cristianas ortodoxos que aún existen– de forma parasitaria respecto del cristianismo, de forma que, ÀQDOPHQWHVXKLVWRULDHVHQORHVHQcial la de su parásito, del capitalismo.” Walter Benjamin, “Capitalism as Religion” (trad. Chad Kautzer), en Eduardo Mendieta, ed. The Frankfurt School on Religion: Key Writings by Santa Rosa (1586-1617), fervientemente venerada por su devoción espiritual extrema y VXVFDVWLJRVFRUSRUDOHVDXWRLQÁLJLGRVHVUHYHODGDSRUHOJUXSRFRPRVtPERORDPELJXRGHGRORU\VXIULmiento extremo asociados a la promesa de felicidad y bienestar de los discursos religiosos y estatales, señalando el rol de los imaginarios místicos en las historias de opresión en la tradición de Occidente.16 /DEHDWLÀFDFLyQGH6DQWD5RVDGH/LPDHQ5RPDHQ\VXFDQRQL]DFLyQSRUHO3DSD&OHPHQWH; en 1671, son interpretadas por el grupo como gestos estratégicos de la Iglesia Católica por consolidar su jerarquía y proclamar el éxito de los procesos de evangelización en América. “Lo que antes ocurría a través de la Iglesia ahora tiene lugar a través de los bancos o los políticos”, señalaba Psotta en 1990, aludiendo a las alianzas ocultas entre el cristianismo y las políticas de explotación y violencia que mantienen un orden económico y moral donde lo sacro es siempre un fetiche o una mercancía.17 En La agonía de un mito maligno (ca. 1983), una de las primeras acciones colectivas reaOL]DGDVEDMRODGLUHFFLyQGH3VRWWDHOJUXSRWHDWUDOL]DVDFULÀFLRVULWXDOHVDODRULOODGHORFpDQR3DFtÀFR En las fotografías se observa a varios personajes en torno a una tienda negra, y alrededor de ella una serie de cuerpos semienterrados, rodeados de velas, emulando un velorio silencioso de cuerpos anónimos: fardos preincas pero también fosas comunes, cementerios indígenas pero también los muertos SRUOD,QTXLVLFLyQ>ÀJ@(QRWUDVIRWRJUDItDVGHHVDPLVPDVHULHDSDUHFHODÀJXUDWUDYHVWLGDGH Santa Rosa que cruza un campo de arena demarcado por banderas negras y cruces, para luego caer derribada y agonizar en los brazos de un personaje que parece Cristo, emulando a la Pietá del artista italiano renacentista Miguel Angel. El imaginario de santas y vírgenes travestis es también investigado en Suburbios (1983), serie producida por Zevallos en colaboración con varios fotógrafos ambulantes y el poeta Frido Martin. A diferencia de otros proyectos del grupo, las fotografías fueron hechas en espacios públicos de la ciudad, como en casonas antiguas, la fachada de un colegio, parques abandonados, entre otros. Las imágenes presentan una coreografía ritual de dos cuerpos andróginos, pobremente travestidos, que HVFHQLÀFDQODFUXHOGDGGHODLFRQRJUDItDFULVWLDQD&RPRVLHVWXYLHUDQLQPHUVRVHQXQDUUHEDWRGH YRFLRQDODPERVFXHUSRVHPXODQHSLVRGLRVGHWRUWXUDFUXFLÀ[LyQ\PXHUWHDVtFRPRGHSODFHUHURWLVmo y éxtasis. Originalmente titulada Pasiones de un cuerpo ambulante, las imágenes convertían el vocabulario visual del martirio en una autopsia social, señalando cómo los esfuerzos máximos de SXULÀFDFLyQGHODOPDLEDQGHODPDQRGHORVJHVWRVPiVDWURFHVGHGHVWUXFFLyQGHOFXHUSR(VWDVHULH que toma también prestados referentes del imaginario barroco religioso, de la cultura popular y de ODSRUQRJUDItD>ÀJ²ÀJ@HVGHVFULWDSRU=HYDOORVFRPRXQD´GDQ]DPDFDEUDURGHDGDGHHV FRPEURVµHQGRQGH´HOFXHUSRGHVQXGRDWDGRSRUYHQGDMHVSHUVRQLÀFDQGRODLPSRWHQFLD\DXVHQFLD GHYHUJHQ]DDQWHHODEDQGRQR>DSDUHFH@FRPRXQDHVWDWXDVHQVLEOHVREUHIUtDSLHGUDHQPHGLR de la tormenta”.18 En otras acciones, realizadas como respuesta a terribles masacres, los dolorosos castigos sobre el cuerpo de Santa Rosa sirven como una analogía explícita de la sordidez de las políticas de exterminio encubiertas bajo la devoción religiosa, que le permitía al poder gubernamental the Major Thinkers (Londres, Routledge, 2005), p. 260. 15 18 Zevallos, “Der Obszöne Tod.” 19 Así lo señala Sergio Zevallos en una entrevista en 1990. Dorothee Hackenberg, “Dieser Brutälitat der Sanftheit,” p. 23. Ya en una entrevista en 1984, Zevallos señalaba claramente los vínculos entre su apropiación de Santa Rosa y la violencia política: “Hay un paralelo, mientras 6DQWD5RVDVHÁDJHOD\VHSURGXFH GRORUItVLFRSDUDVHUPRUWLÀFDGDHQ este país se torturan y se deshacen cuerpos y para ellos no hay perdón.” Miguel Silvestre, “A propósito de una PXHVWUDGH¶&KDFODFD\R·&XDQGR el ser auténtico resulta ser peligroso,” El Diario de Marka, Lima, 27 de noviembre de 1984, p.18. Reproducido en este libro en la página 115. /D¶PDVDFUHGHORVSHQDOHV·IXH la represión política y militar que tuvo lugar el 18 y 19 de junio de 1986, como respuesta a un motín de presos acusados de terrorismo en varias cárceles de Lima. El motín fue un intento de capturar la atención internacional de los medios de prensa justo antes de celebrarse el XVII Congreso de la Internacional Socialista (Lima, 20–23 de junio, 1986), organizado por vez primera en América Latina. Este episodio fue uno de los asesinatos masivos más grandes de la década. 21 Achille Mbembe, “Necropolítica,” en Helena Chávez Mac Gregor, ed. Estética y violencia: necropolítica, militarización y vidas lloradas (México D.F., MUAC, 2012), p. 135. DSDUHFHU¶FRQODFDUDOLPSLD·OXHJRGHFRPHWHUORVPiVDWURFHVFUtPHQHV19 En la serie de fotografías Rosa Cordis (1986), realizada por Zevallos nuevamente en colaboración con Martin, un personaje travestido y semidesnudo, con velos y una corona de espinas, se maquilla, para luego masturbarse al lado de lo que parece un cuerpo muerto que cae violentamente en un cubículo teñido de rojo y FXELHUWRGHUHFRUWHVGHUHYLVWDVSRUQRJUiÀFDV(QODVLJXLHQWHLPDJHQODVDQWDVHKDFRQYHUWLGRHQ un personaje encapuchado que sodomiza el cadáver. Rosa Cordis fue una reacción a algunas cuestionables acciones del gobierno peruano, principalmente la condecoración con la Orden del Sol del Perú que recibió Santa Rosa de Lima por el cuatricentenario de su nacimiento, una medalla dedicada a ciudadanos destacados. Este hecho tuvo lugar poco antes de la cruel masacre de los penales donde se asesinaron a numerosos presos ya rendidos en Lima.20 Esta ceremonia pública de condecoración, liderada por autoridades gubernamentales, fue una liturgia que el Grupo Chaclacayo interpretó como un intento de limpiar la responsabilidad política en la guerra de la casta política y militar a toda costa. Cadáveres Las obras del grupo buscaron poner en evidencia cómo las falsas nociones de soberanía y gobernabilidad estatal servían para ejercer violencia sobre aquellos que ponían en peligro la aparente legitimidad del Estado. Estos mecanismos de exclusión –que iban desde el encierro en cárceles u hospitales hasta la masacre y el genocidio militar– aparecen una y otra vez en sus trabajos como maneras de interrogar las formas totalitarias de administración de la muerte en la vida contemporánea. Esa “instrumentalización generalizada de la existencia humana, y la destrucción material de los cuerpos \>SREODFLRQHV@MX]JDGRVFRPRGHVHFKDEOHVRVXSHUÁXRVµHVFRPRVHxDODUtDHOÀOyVRIRFDPHUXQpV Achile Mbembe, lo que hizo de la muerte el aparato privilegiado de dominación política desde tiempos coloniales, siendo la muerte el primer motor de la modernidad y aún hoy el más efectivo aceite de la máquina capitalista.21 $OHVFHQLÀFDUODVIDQWDVtDVFRORQLDOHVHXURSHDVGHVGHVXUHYHUVRVLQLHVWURGHVGHHOFDGiYHU –el despojo de una muerte irrepresentable–, el Grupo Chaclacayo equiparó certeramente las promesas de progreso occidental con los restos humanos que nadie quiere ver, esos remanentes sin nombre de las economías de la guerra y la ocupación. En varias obras de Zevallos, marcas visuales como las bandas negras colocadas sobre los ojos de menores de edad, víctimas de la brutalidad policial, son usadas HQGLEXMRVTXHUHWUDWDQFXHUSRVPDVDFUDGRV\HQDJRQtDSHUPDQHQWH>ÀJÀJ@(QRWUDVREUDV VRQODVÀJXUDVUHOLJLRVDVFRPRODVLOXHWDGHOD%HDWLWDGH+XPD\²ODKXPLOGH/XLVDGHOD7RUUHQDFLGD en el departamento de Ica en 1819 y venerada por curar toda clase de enfermedades–, las que aparecen convertidas en personajes siniestros que acompañan cuerpos yacentes, cuerpos heridos, torturas \HQWLHUURV>ÀJ²ÀJ@ 16 22 Hackenberg, “Dieser Brutalität der Sanftheit,” p. 23 17 23 Un aspecto importante de mencionar es la profusa circulación de las imágenes asociadas al culto de la santa popular Sarita Colonia, la cual es aludida en diversas producciones artísticas, poéticas y musicales de la época, entre ellas en el trabajo del colectivo E.P.S. Huayco (1980-1981). Esta relación y tensión entre las apropiaciones contraculturales de Sarita Colonia y los travestismos religiosos de Santa Rosa de Lima por parte del Grupo Chaclacayo, merece un análisis que excede los límites de este ensayo. Sobre la imagen Sarita Colonia desde las (VWDVLPiJHQHVVRQWDPELpQXQDUHDFFLyQYLVFHUDODOFRQVWDQWH¶HVWDGRGHHPHUJHQFLD· GHFODUDGRSRUHOJRELHUQRSHUXDQRDQWHXQFRQÁLFWRDUPDGRGHVFRQWURODGRDOLPHQWDGRSRUODUDELDGH amplias mayorías sometidas largamente al olvido, la discriminación racial y la segregación social. &RPRHQPXFKRVRWURVPRPHQWRVGHODKLVWRULDHVH¶HVWDGRGHH[FHSFLyQ·H[WHQGLGRVLUYLySDUDOHJLWLmar la represión, la persecución política, las ejecuciones y entierros extrajudiciales, los cuales se implementaron como estrategia militar contrasubversiva, aplicadas principalmente contra comunidades quechuahablantes y de origen indígena de los Andes centrales –en estas poblaciones se ha encontrado el mayor número de fosas comunes en el país desde 1983. Es precisamente la imagen de la fosa común –miles de cuerpos torturados, desaparecidos y enterrados clandestinamente– el signo que nos introduce a toda una genealogía macabra de la barEDULHHQGRQGHODVWpFQLFDVGHGHVDSDULFLyQ\ODVHVWUDWHJLDVGHH[WHUPLQLRQRKDQGHMDGRGHVRÀVWLFDUVH>ÀJ@/DDOXVLyQHQODVREUDVGHOJUXSRDHVWHLQYHQWDULRPRGHUQRGHFDGiYHUHVIXHXQHMHUFLcio de reconocimiento de los parentescos entre el imaginario del genocidio y los campos de concentración de la Alemania nazi, pasando por las guerras civiles en Europa, la máquina militar asesina de la Operación Cóndor y los centros clandestinos de detención de las dictaduras en América del Sur, hasta el arrasamiento producto de la guerra popular maoísta en el Perú. “Cuando en [la Universidad NacioQDOGH@6DQ0DUFRVVHHQFXHQWUDXQOLEURGH0DU[R0DUFXVHXQRHVLQPHGLDWDPHQWHWRUWXUDGRGHVDSDUHFHRHVDVHVLQDGR(VWRHVVyORXQHMHPSORGHHVWHÀQGHOVXHxRHXURSHRDOJRTXH0DU[SUREDEOHmente nunca se hubiese podido imaginar” decía Psotta en 1990, en relación al destino trágico que los discursos emancipatorios nacidos de la modernidad europea occidental han tenido en otros escenarios, y acaso señalando también la colonialidad implícita en ciertas teorías revolucionarias.22 Sin embargo, la aparición de enterramientos travestis, bultos hermafroditas y momias andróginas en su obra sugiere también una guerra distinta, subterránea, inadvertida: la guerra declarada FRQWUDORVFXHUSRVDIHPLQDGRVUDURVIHRVPRQVWUXRVRV>ÀJ@(OSODFHUVRFLDOTXHSURGXFHODVHQtencia de muerte del homosexual, el anhelo de desaparición de los cuerpos sexo-disidentes, emerge en el trabajo del grupo como un modo de torcer las hipótesis tradicionales imperantes sobre los orígenes GHOFRQÁLFWRDUPDGRHQ3HU~&RQWUDULRDHVWDVKLSyWHVLVHO*UXSR&KDFODFD\RVLW~DXQRGHORVRUtJHQHV de la violencia en las ideas y modelos de capacidad y heteronormatividad, los cuales son integrales a ODJXHUUDGHFODUDGDFRQWUDORVVXMHWRVTXHGHVREHGH]FDQORVUHJtPHQHVKHJHPyQLFRVGHOR¶QRUPDO·\ contra aquellos cuerpos que no son útiles para las demandas productivas del capitalismo –los seropositivos, los discapacitados, los transgénero, los sin papeles, entre otros. (QXQDGHVXVVHULHVPiVVLJQLÀFDWLYDVWLWXODGDSangre y Ceniza. Variaciones sobre la bandera (1987), Zevallos ultraja la imagen de la bandera peruana en dibujos donde cuerpos sin cabeza, sin brazos, sin piernas, se confunden con escenas de desangramiento, sadomasoquismo y penetración anal. Los dibujos estallan la carne sin piedad, destruyendo también toda memoria heroica: en esa bandera no hay nada que celebrar más allá de las huellas del asesinato, la dominación y la castración. La profanación pansexual de la bandera aniquila las ansias heterosexuales de reproducción de la demandas de una cultura revolucionaria popular véase Roger Santivañez, “Sarita Colonia, la chicha y la izquierda nacional,” Somos, revista de El Comercio, Lima, 1983, p. 19. Sobre el trabajo de E.P.S. Huayco ver Gustavo Buntinx, ed. E.P.S. Huayco. Documentos (Lima, MALI, CCE e IFEA, 2005). 24 Beatriz Preciado, “La Ocaña que merecemos. Campceptualismo, subalternidad y políticas performativas,” en: Ocaña: 1973–1983: acciones, actuaciones, activismo, Barcelona, ,QVWLWXWGH&XOWXUDGHO·$MXQWDPHQW de Barcelona, 2011, p. 110. QDFLyQREOLJiQGRQRVDVHQWLUHOFXHUSR QDFLRQDO GHVGHVXVRULÀFLRVUHSULPLGRV\UHVWLWX\HQGRXQ imaginario pagano primitivo que desmantela el racismo y la homofobia patrios, dos de los pilares constitutivos del Estado-Nación moderno. Esa proliferación de cadáveres maricas puede leerse también como una alusión a los procesos de limpieza social que equiparan homosexualidad y muerte, promiscuidad y criminalidad, deslegitimando las formas no-monogámicas y no-normativas de sexualidad. Algo que se refuerza más aún durante los años 80, en donde la crisis del VIH/SIDA impulsa el surgimiento de nuevas formas gubernamentales de control del cuerpo, los cuales reavivan las formas violentas de denigración y persecusión de la desobediencia de género en la esfera pública. Semen y pólvora Las acciones y representaciones de Sergio Zevallos en torno a religiosidad andrógina y maricona pueden entenderse también como un intento de activar historias de devoción no normativa y rituales travestis que han sido constantemente suprimidos de la historia. El uso del imaginario católico que exalta formas EDUDWDVGHUHSUHVHQWDFLyQ\FRQVXPRGHYtUJHQHV\VDQWRVORFDOHVHVWDEOHFHRSHUDFLRQHVGHLGHQWLÀFDción con una cultura popular y lumpen (todo aquello considerado pobre y vulgar desde la mirada urbana de las clases altas), intersectado con imágenes de prótesis, cruces, retratos de niños, sangre, cuerpos mutilados, pólvora y semen, abriendo un espacio renovado de antagonismo político.23 De diferentes maneras, estas imágenes evocan lo que la teórica queer Beatriz Preciado ha descrito como la “atracción inconfesable entre el militar y el marica, entre el marichulo y la loca, entre el policía y la puta, entre el artista y el analfabeto, entre la estética de los mártires y la cultura sexual sadomasoquista”.24 (VWDVIRUPDVPDULFDVGHWHDWUDOL]DFLyQGHOSRGHU\GHUHVLJQLÀFDFLyQGHODPRUDOLGDG UHOLJLRVDSXHGHQVHUWDPELpQDVRFLDGDVDXQDPSOLRUHSHUWRULRGHGHVREHGLHQFLDVGHJpQHUR\ÀHVWDV paganas raramente discutidas. Por ejemplo, los dibujos de falos-altares inspirados en la Virgen de *XDGDOXSHGHODDUWLVWDPH[LFDQDIHPLQLVWD0yQLFD0D\HUDÀQHVGHORVDxRVORVUHFLHQWHVSRVWHU y stickers impresos con oraciones por el derecho al aborto distribuidos gratuitamente por el colectivo argentino feminista Mujeres Públicas; las experiencias litúrgicas y subversivas del dúo Yeguas del $SRFDOLSVLVDOÀQDOGHODGLFWDGXUDPLOLWDUHQ&KLOHORVQXPHURVRVDXWRUUHWUDWRVKRPRHUyWLFRVFRQ iconografía católica del pintor mexicano Nahum Zenil; los recientes peregrinajes de la primera santa trans chilena Karol Romanoff, organizados por la Coordinadora Universitaria de Disidencia Sexual; RODVDSDULFLRQHVVXEUHSWLFLDVGHOÀOyVRIR*LXVHSSH&DPSX]DQRWUDYHVWLGRFRPRYLUJHQDQGLQDHQOD ciudad de Lima, entre varias otras. Este conjunto amplio de resistencias sexo-políticas posicionadas contra el sistema disciplinario de la diferencia sexual no demanda la inclusión en los valores mayoritarios, sino una transIRUPDFLyQUDGLFDOGHFLHUWRVVLVWHPDVGHVLJQLÀFDFLyQ\HVWUXFWXUDVVRFLDOHVTXHHWLTXHWDQFLHUWRV FXHUSRVQRQRUPDWLYRVFRPR¶GHVFRPSXHVWRV·$VtWDPELpQYDULDVREUDVGHOJUXSRDWDFDQORVPRGHORV 18 25 Algunas de estas ambientaciones nunca exhibidas son descritas minuciosamente por Gustavo Buntinx en “Una experiencia extrema en nuestro arte,” Caballo Rojo, suplemento de El Diario Marka, Lima, 28 de marzo de 1983, p.10. 26 "Ya en Berlín comprobé como la sana preocupación por el Perú suele ir pareja a la distorsión. (...). De regreso a Occidente decido ver si podía perderme en Berlín pero marcho antes al Bethanien para hablar con su director, el Dr. Haerdter, quien me muestra el lujoso catálogo de su próxima atracción: Nada menos que los terribles chicos del Grupo Chaclacayo que llegaban luego de una llamativa tour en la que mezclaban, en católicos de familia tradicional. En varias ambientaciones fúnebres tempranas, Raúl Avellaneda 25 despliega sus retratos personales y familiares como un comentario sobre la violencia sexual y racial vivida durante su infancia de manera cotidiana. Avellaneda construye ensamblajes, dibujos y objetos –particularmente en su serie Letanías Acalladas (1984-1988) y sus fotografías de escenas domésticas de 1986– donde el cuerpo castrado y las identidades reprimidas se liberan para construir un nuevo orden poético rabioso, abyecto y perverso. El potencial político de todas estas prácticas reside precisamente en su capacidad de fracturar el entendimiento colectivo de lo que debe ser un cuerpo social deseable. Por ejemplo, en series como Ambulantes (1984), Detritus (1986), o Algunas tentativas sobre la Inmaculada Concepción (1986), Zevallos ha explorado otras formas de sociabilidad y sexualidad, afecto y erotismo entre lo vivo \ORLQHUWHHQWUHORDUWLÀFLDO\ORKXPDQR6XVLPiJHQHVUHJLVWUDQHQWLGDGHVHQXQGHVSOD]DPLHQWR permanente: cuerpos transgénero, hermafroditas, migrantes, cuerpos intersexuales, vagabundos. Devolver a la mirada pública aquello que ha sido expulsado y marcado como anormal o enfermo es una operación que ensancha los límites de lo público en un proceso donde aquellos cuerpos que tenían negado el estatus de humano adquieren, por otras vías, la posibilidad de ser sujetos de enunciación, de ser agentes políticos de producción de conocimiento. Para Zevallos es el travestismo –en tanto trastorno, apropiación y malcitación de los códigos culturales– la operación privilegiada para desnaturalizar el poder, invertir las jerarquías y UHVLJQLÀFDUODKLVWRULDSROtWLFDGHORVFXHUSRV6XVLPiJHQHVVRQexorcismos tóxicos lanzados como proyectiles contra la memoria social. Por un lado exorcizándola del hechizo totalitario hasta convertirla en gozosas representaciones de una desobediencia capaz de permitirnos seguir respirando frente a XQDSHVDGDFXOWXUDKHWHURQRUPDWLYD<SRURWURKDELWDQGRDÀUPDWLYDPHQWHODYHUJHQ]DODLQIHFFLyQ la toxicidad y la enfermedad, para allí desactivar violentas categorías sociales de exclusión. Esa producción contra-sexual del cuerpo desmonta poderosamente todo un sistema que hará lo posible por FRQÀQDUDTXHOODVIRUPDVGHGLVLGHQFLDERUUDUODVGHODPHPRULDQRUPDOL]DUODGLIHUHQFLD(VWDVSHUIRUmatividades son así también una demanda por imaginar nuevos contratos sociales y modelos de acción política que surjan desde la anormalidad, desde lo múltiple y lo vulnerable. La construcción que cierta crítica conservadora hace de estos cuerpos como entes desadaptados, como elementos que requieren una rehabilitación siquiátrica e incluso penitenciaria, no deja de acechar las gramáticas homoeróticas del grupo. En un artículo de 1989, el crítico Luis Lama (quien había sancionado moralmente y patologizado sus prácticas en 1984) acusa esta vez el trabajo del grupo, H[KLELGRHQHO.QVWOHUKDXV%HWKDQLHQGH%HUOtQGHVHUXQD¶HVWULGHQWH\IUtYRODDSRORJtD·DODRUJDQLzación subversiva Sendero Luminoso.260iVDOOiGHOULHVJRTXHVLJQLÀFyDTXHOODGHQXQFLDSDUDORV DUWLVWDV HQHVHPRPHQWRHOORSRGtDVLJQLÀFDUODSHUVHFXFLyQHOVHFXHVWURODWRUWXUDRODGHVDSDULción), resulta revelador la manera en que ciertas irrupciones anarco-mariconas son asociadas al terror producido por las incursiones armadas de Sendero Luminoso en el país. 19 un mismo saco, castraciones y cruciÀ[LRQHVEODVIHPLDV\SHQHWUDFLRQHV asesinatos —a cargo de nuestras Fuerzas Armadas, claro está— y liberaciones. Todo ello en un espeso menjunje ideológico-sadomasoquista, que resulta tan excesivo que sólo los incautos podrían tragarse la píldora. Cinco años atrás la posición política del grupo era reducida a una suerte de misa negra homosexual, con descripción explícita de perversiones, que intentaba subvertir hábiWRVHQXQDFLXGDG>/LPD@GRQGHHO vicio no escandaliza ni la virtud encandila. Ahora en Alemania, guiados por Herr Psotta, el cabecilla alemán, y frente a una nueva clientela la propuesta se ha radicalizado en su evidente deseo de denunciar la represión y el asesinato político (sic). Para estos propósitos el catálogo incluye testimonios conocidos, como fotos de masacres —a cargo de militares— y una cronología que, por decir lo menos, resulta parcializada. Nuevos colaboradores han ingresado, como la Sra. Sybilla Arredondo, quien gentilmente ha cedido un texto de José María Arguedas, que se incluye junto a otros, entre ellos uno del mismo Psotta, quien se explaya sobre los alcances de la corrupción. Él, indudablemente, debe ser un experto en el tema, al lograr reducir el asesinato senderista en una necrofílica alegoría freudiana en la que se unen el sexo, la sangre y la mierda para provocar el terror." Luis Lama, “Perversión y Complacencia,” Caretas, Lima, 20 de noviembre de 1989, p.74-76. La denuncia de Lama representa un ejemplo poderoso de cómo las expresiones inapropiadas de sexualidad pueden ser interpretadas como un peligro capaz de poner en riesgo el cuerpo QDFLRQDO\VXVIRQWHUDVQRUPDWLYDV(TXLSDUDU¶WHUURULVWDV·FRQ¶PDULFRQHV·DXQTXHVHDVXWLOVHxDOD FyPRHVWDWHDWUDOLGDGKLSHUVH[XDOL]DGD\ÀFFLyQPDULFDWXOOLGDTXHPH]FODDOVROGDGRFRQHOFXUD\ el niño con el cadáver, puede ser una metáfora tan explosiva y amenazadora para el cuerpo social como la violencia asesina de Sendero Luminoso. Miguel A. López (Lima, 1983) Migrante. Escritor, artista e investigador sobre las intersección de cultura visual, género, sexualidad y política. Sus textos han sido publicados en revistas como Afterall, ramona, (ÁX[MRXUQDO, Manifesta Journal, Art in America, The Exhibitionist, Art Nexus, entre otras. Entre sus publicaciones recientes están Giuseppe Campuzano. Saturday Night Thriller y otros escritos, 1998-2013  XQDFRPSLODFLyQGHORVHVFULWRVGHOÀOyVRIRWUDYHVWL Giuseppe Campuzano; ¿Y qué si la democracia ocurre? (2012, co-editado con Eliana Otta), un libro sobre visualidad, política y democracia; un catálogo sobre la artista conceptual Teresa Burga (2011, co-editado con Emilio Tarazona), y un número marica de la revista ramona (2010, co-editado con Fernando Davis). Ha curado recientemente Perder la Forma Humana. Una imagen sísmica de los años 80 en América Latina junto con la Red Conceptualismos del Sur en el MNCARS, Madrid (2012-2013); y Pulso Alterado, junto a Sol Henaro, MUAC-UNAM, México, 2013. Actualmente desarrolla como curador invitado dos exposiciones sobre travestismo y cultura popular para Utopian Pulse en Secession de Viena (2014), y para la 31ª Bienal de Sao Paulo Como hablar de cosas que no existen (2014). 20 1 Part of this research was conducted in collaboration with the Peruvian researcher and art critic Emilio Tarazona between 2008 and 2011. For a preliminary version of this text see Miguel López, “Queer Corpses: Grupo Chaclacayo and the Image of Death”, in (ÁX[ ,P SUDFWLFDO (Im)possibiliites, ed. Carlos Motta, $SULOKWWSZZZHÁX[FRP journal/queer-corpses-grupo-chaclaFD\RDQGWKHLPDJHRIGHDWK@ 2 This book collects the most important texts and art critiques about Grupo Chaclacayo published in Peru and Germany between 1982 and 1991. During the last decade Emilio Tarazona has written the most im- Toxic Exorcisms. Sergio Zevallos in the Grupo Chaclacayo 1 Miguel A. López *UXSR&KDFODFD\R·VSURIRXQGO\WUDQVJUHVVLYHVH[XDOO\ dissident work remains relatively unknown today. The stories about this collective have been circulating in Peru since the eighties like a myth or a rumor due largely to the limited literature on their production, as well as the fact that the members left the country for Germany in 1989.2 Many stories have emerged through the frame of polemics UDLVHGDURXQG&KDFOD\R·VZRUN(YHQVRPHGHURJDWRU\ comments made by conservative cultural critics of the time tended to ridicule or pathologize the way the group approached political violence and directly addressed the decadent militarism, religious theatricality and exacerbated sexuality in a male dominated, misogynist and homophobic society.3 The inadequacy of their practices in the eyes of the traditional artistic disciplines (painting and sculpture), its distance from the cultural escene, as well as their inability to slot into the traditional critical repertoire of the left, lead to the intelligibility of their work for many who approached it. Their work was largely forgotten when the group relocated to Germany in 1989 as they brought much of the docuPHQWDWLRQZLWKWKHPWKXVPDNLQJLWGLIÀFXOWWRWUDFH7KLV situation not only delayed the possibility to affect (and infect) the local history of art but also prevented a dialogue between this historical moment and a wider genealogy of social struggle and practices of gender disobedience where blasphemy and orgy have long been powerful forms of critiquing colonial, military, racial, religious, classist and heteronormative power. This is a tradition that brings us from 0DUTXLVGH6DGH·VHMDFXODWLRQLQWRDFKDOLFHLQWKHHLJKteenth century to the artistic duo Yeguas del Apocalipsis who produced theatrical liturgical collaborations with transvestites and prostitutes throughout the last years of the dictatorship in Chile. portant readings about the work of Grupo Chaclacayo. For a reference of 7DUD]RQD·VWH[WVVHHWKHELEOLRJUDSK\ on this book. From a gender perspective, the artist and professor Miguel *DUFtDUHÁHFWHGRQ6HUJLR=HYDOORV·V transvestite performances as a pioneering episode for Peruvian artistic queer practices. See Miguel García, “Auténticos, Destructores, Forajidos y Amorosos: Políticas corporales y nuevas estéticas en una ciudad interminable,” in Jorge Bracamonte, ed. De amores y luchas: diversidad sexual, derechos humanos y ciudadanía (Lima: Centro de la Mujer Peruana Flora Tristán, 2001), pp. 231-252. 3 See the article by Peruvian art critic Luis Lama, “Pobre Goethe,” Caretas, Lima, 3 December, 1984, p. 63. This and other examples of /DPD·VZRUNDUHGLVFXVVHGLQWKLV essay. Recently the art critic Manuel Munive referred to the open sexuality RIWKHDUWZRUNVWRUHMHFW=HYDOORV·V ZRUN²DQG*UXSR&KDFODFD\R·VZRUN in general. Munive proposes that ZeYDOORV·VZRUNJRHVWKURXJKWKH “beaten path of aesthetic onanism.” See Manuel Munive, “Inkarri. Vestigio barroco,” Illapa Revista del Instituto de Investigaciones Museológicas y Artísticas de la Universidad Ricardo Palma, Lima, n. 2 (December, 2005), pp. 127-128. The work of Grupo Chaclacayo, made between Peru and Germany, was a project of sexual and affective cohabitation and collaboration that lasted around twelve years (1982-1994). The group emerged in the early eighties in the middle of a violent war between the Maoist organization Shining Path and the Peruvian state. While the group was initially formed by three artists –the German artist and professor Helmut Psotta (Ruhrgebiet, 1937- 2012) and the Peruvian artists Raúl Avellaneda (Lima, 1960) and Sergio Zevallos (Lima, 1962) – they relied on the collaboration of various friends over the time. Psotta, Avellaneda and Zevallos exiled themselves to a warehouse space in the district of Chaclacayo in the suburbs of Lima, where they lived for more than six years beginning in 1982. The group had a single exhibition at the Lima Art Museum in November 1984 and later they continued to produce drawings, sculptures and photographs that were never exhibited in Peru. During those years, the group lived modestly through personal economic contributions of Helmut Psotta, who had to travel more than once to Germany for funds. In January 1989 they decided to leave the country because of the scarcity of economic resources and the social hostility of a country submerged in an internal DUPHGFRQÁLFWWKDWZRXOGOHDYHQHDUO\GHDGRYHU two decades (1980-2000).4 The artists took with them all WKHPDWHULDOWKH\KDGSURGXFHGDQGZKDWWKH\FRXOGQ·W transport to Europe, they burned, carrying the ashes over in a small container. After arriving in Germany, a few months before the fall of the Berlin Wall, Grupo Chaclacayo produced a retrospective exhibition entitled Todesbilder. Peru oder Das Ende des europäischen Traums [Images of Death. 3HUXRUWKH(QGRIWKH(XURSHDQ'UHDP@,WZDVSUHVHQWHG in museums and institutions in Stuttgart, Bochum, KarlsUXKHDQG%HUOLQ>ÀJ@5 As part of these exhibitions the collective developed a series of performances, whose point of departure was torture and obscenity. For the performances the group presented a series of profoundly visceral VLWXDWLRQVZLWKRXWDSUHGHÀQHGVFULSWWKH\PL[HGPXVLF by Bach, Mozart and Schubert, images of popular fascist singers, texts by Goethe and Rilke, stuffed animals, balloons and dummies, hymns and military march songs, characters from German children stories, religious writings of St. Teresa of Avila, among other elements. With this ritualistic and aggressive language the group sought to connect the legacy of colonialism in Latin America, the 7KHDUPHGFRQÁLFWLQ3HUXHQGHG in 2000 with the fall of the right-wing dictator Alberto Fujimori and his criminal and corrupt government. The principal actors in the war were the Shining Path Maoist organization, the guerrilla group Túpac Amaru Revolutionary Movement (or MRTA), and the government of Peru. All of the armed actors in the war committed systematic human rights violations and killed civilians. 5 The show toured between 19891990 at the Institut für Auslandsbeziehungen in Stuttgart (19 April – 21 September, 1989), the Museum Bochum (July 15 – 27 August, 1989), the Badischer Kunstverein in Karls- ruhe (September 21 – October 29, 1989) and the Künstlerhaus Bethanien in Berlin (January 19 – February 18, 1990). The exhibition was also presented in the DDR at the Galerie am Weidendamm of the Zentrum für Kunstausstellungen (May 9-27, 1990), and at the Maxim Gorki Theater where the group presented some lives performances ²DWWKH7KHDWUH·VIR\HUWKHJURXS exhibited a photo retrospective of its work that was quickly censored. 6 Their last presentation as a group was at Fest III (September 29— October 3, 1994) in Dresden. The Yugoslav/Slovenian band Laibach, the dance-theater company Beton- defeat of the left guerrilla movements by the military dictatorships in the South, the Maoist war in Peru and the IDOORIFRPPXQLVPDQGWKHUHXQLÀFDWLRQRI*HUPDQ\$IWHU various performances and other presentations, the group ended their collaboration in 1995.6 The borders of the Grupo Chaclacayo situation are imprecise because the intimate relations of the members GHÀQHWKHFRPSRVLWLRQRIWKHJURXS,Q/LPDWKHDUWLVWV lived isolated from the main cultural scene, although various critics and artists were invited to visit their work and living space. There were also regular visits from friends, some of whom were invited to live with the group where they worked collaboratively in the production of actions and photographs. Throughout the years Jorge Angeles, the craftsman and jelewer Sixto Paniora, the poet Frido Martin and the German artist Klaus Wittkamp were some of the most important external participants of the JURXSZKRVHFRPSRVLWLRQZDVRIWHQPRPHQWDULO\LQÁX[ 'XULQJWKHÀUVWWZR\HDUVWKH\DOVRKDGWKHFROODERUDWLRQ of the photographers Cesar Guerra and Piero Pereira. 7KHJURXS·VSURGXFWLRQZDVDQH[SORVLYHUHZRUNLQJ of the waste of the city: they fused representations of mystical pain, religious martyrdom and thousands of images of tortured and mangled bodies – the product of the YLROHQFHDQGLQWHUQDODUPHGFRQÁLFW>ÀJ@7KHKRUURU and incomprehension (as much as the fascination and seduction) their experiments provoked was the result of the obscurity of their work: the cheap, anti-glamorous staging of ideological dogmatism, the homoerotic representations EHWZHHQVDFULÀFHDQGQHFURSKLOLDPLOLWDU\SRZHUUHVLJQLÀHGWKURXJKWUDQVYHVWLVPWKHDOOHJRULHVRIVRGRP\DQG sinful sexualities, the performances and actions that emSOR\HGFRIÀQVDQGFRUSVHVDVZHOODVDOOXVLRQVWRIHWXVHV KXPDQUHPDLQVDQGERGLO\ÁXLGV>ÀJ@,QWKHLUZRUN bodies always appear in strange metamorphoses: androgynous bodies become mutilated bodies; victimizers who are also victimized; bodies who give birth only to destroy themselves. Their work was an experiment in the producWLRQRIVXEYHUVLYHVXEMHFWLYLWLHVWKDWGHÀHGH[LVWLQJVRFLDO categories. WDQFWKHÀOPPDNHU/XW]'DPPEHFN and the artist and theoretician Peter Weibel also participated in this festival. 7 The German artist had already established a career as a professor giving seminars and lectures at the Rijksakademie van Beeldende Kunsten in Amsterdam, the Jan van Eyck Academy, the Maastricht Academy of Fine Arts, the AIVE School of Design LQ(LQGKRYHQWKH¶0LQHUYD·6FKRRORI Art and the Ubbo Emmius Groningen Institute as well as teaching in the design faculties of the Bielefeld and Düsseldorf, among others. In the sixties Psotta had participated in the foundation and direction of the Insti- tute of Design in the Architecture 'HSDUWPHQWDWWKH3RQWLÀFDO&DWKROLF University of Chile and it was here that he met the Austrian vitralist painter Adolfo Winternitz who was then the director of the School of Art at the Catholic University of Peru. It was Winternitz who invited Psotta years later to join the art faculty in Lima. (Conversations with Helmut Psotta, Galhen and Berlín, 20092010). 8 Both Bryce and Martin collaborated on other kinds of interventions into public space. At that time Bryce was a drummer in the band Durazno 6DQJUDQGR>%OHHGLQJ3HDFK@ZLWKWKH poet Rodrigo Quijano and Octavio The withdrawal The group was formed as a result of the closeness of three artists at the School of Art at the Catholic University of Peru. When German professor Helmut Psotta arrived at the art school in Lima in March 1982, he was responsible for JLYLQJDVHULHVRIFRPSRVLWLRQDQGGHVLJQVHPLQDUVWRÀUVW and second year students as well as other classes where he met Avellaneda and Zevallos who were students at the time.7 In one of these courses Psotta proposed to produce work around the theme of torture with the intention of challenging the conservative boundaries of the university. He asked his students to collect images from the press that showed violence and death and encouraged them to work with them in his classes. These seminars not only provoked a hostile reaction from some of his students but LWDOVRFDXVHGFRQFHUQIRUWKHDUWVFKRRO·VDXWKRULWLHVZKR began to distrust the professor and his work. One of the most important actions made by the JURXS²EHIRUHWKH\KDGRIÀFLDOO\FRPHWRJHWKHUDVDZRUNing collective – was a procession carrying an altar of blasphemous images made from waste and found materials. Hung to the sides of the altar were two portraits: an image of the Chilean dictator Augusto Pinochet and a portrait of WKH6DQWD5RVDRI/LPD>6DLQW5RVHRI/LPD@>ÀJ@7KH totem, produced by Sergio Zevallos, was clearly inappropriate for the aesthetic values of the academy. However, what was more controversial was the act of carrying the object through the halls of the university and later taking it outside to the streets and wandering through the surrounding QHLJKERUKRRGVRQWKHZD\WRKLVSDUHQW·VKRXVHZKHUHWKH SURFHVVLRQZDVWRÀQLVK7KHSRHW)ULGR0DUWLQ²ZKRZRXOG later collaborate with Zevallos in various photographic series– participated in the procession, as did the artist Fernando Bryce who played a large waste disposal container as an instrument, parodying and de-naturalizing a common FDWKROLFULWXDO>ÀJ@8 During this time Psotta was continually harassed by the department and school authorities until his decision to leave the university and move in with Zevallos and Avellaneda in a house in the Chaclacayo district in the outskirts of Lima. His decision was an attempt to create a distance from the art system, from its economic rule and traditional models of good taste. The collaboration between Zevallos and Avellaneda would begin, however, long before the arrival of Psotta in Lima. They established an affective relationship together 22 Susti. This group had close ties to the poetry group Kloaka (19821984), which Frido Martin also participated in. See Roger Santivañez, “Música joven: Entre la chicha y el rock,” in Revista de la Semana, supplement of El Observador, n. 18 (Lima, 3 April, 1983). 9 For a short history about the begJLQLQJVRIWKH/LPD·VXQGHUJURXQG scene, see Carlos Torres Rotondo, Se acabó el show. 1985. El estallido del rock subterráneo (Lima: Editorial Mutante, 2012) and Shane “Gang” Greene, “Notes on the Peruvian Underground: Part II,” Maximum Rocknroll, San Francisco, n. 356 (January, 2013). around 1980 – a little after Zevallos began studying at the university. Together they made a series of spontaneous transvestite actions. In 1980 during a trip to Canta (in the northeast of Lima near the Andes), Zevallos made a transvestite self-portrait of himself on the shore of the river Chillón. The image portrays a character holding a wooden stick and wearing a white wig in an allusion to a libertine IURPWKH%DURTXHHUD>ÀJ@7KHSKRWRJUDSKZKLFKZDV made in collaboration with Avellaneda, mimicked the theatricality and sensuality of catholic visuality (crowns, ÁRZHUVIDFHVSDLQWHGLQPDNHXSDQGH[SUHVVLRQVRI HFVWDV\ >ÀJ@7KHVHVWUDWHJLHVDUHDSUHOXGHWRRWKHU self-portraits that Zevallos made in 1984 such as Martirios >0DUW\V@ZKLFKZDVLQVSLUHGE\DQLPDJHRIWKH0DWHU Dolorosa. In 1982, with the arrival of Psotta at the university, the three began a profoundly intense sexual and emotional relationship that allowed for the initiation of a dialogue spanning themes of common interest such as religion, sexuality and politics, all of which would ultimately be at the center of their artistic production and creative connection. =HYDOORVDQG$YHOODQHGD·VLPDJHVIURPDV well as the spontaneous alter processions at the university, are an early articulation of the performative and scenographic grammars of the work of Grupo Chaclacayo. The actions performed by the collective are characterized by symbols associated with fanaticism, religion and ideology: DSRSH·VPLWHUWKDWEHFRPHVWKHKRRGRIWKH.OX.OX[.ODQ Christian crosses that become Nazi swastikas as if they are all lost relatives of the same genealogy of totalitarianism. Grupo Chaclacayo produced a terrifying theatrics of destruction that makes visible the social and political effects of European colonization, military occupation and the evangelical religious crusades of the sixteenth century. Their images seek to link the past with the present, opulence with misery, eroticism with brutality. Thus, between 1982 and 1988, the house is the place to rehearse new states of freedom, giving life to a profane sexual iconograSK\WKDWUHVLJQLÀHVWKHODQGVFDSHRIWHUURUGHDWKDQGH[termination distributed in the media and newspapers daily. 10 In 1983, a succession of largescale deaths stir a preoccupation and public discussion about the violence on a national scale; the ¶VODXJKWHURI8FKXUDFFD\·LQZKLFK eight journalists were assassinated by forty members of a community with military training, who confuse the journalists with members of 6KLQLQJ3DWKWKH¶VODXJKWHURI /XFDQDPDUFD·ZKHUH6KLQLQJ3DWK DVVDVVLQDWHGSHDVDQWVWKH¶NLOOLQJRI6RFRV·ZKHUHSHDVDQWV were assassinated by members of the ex-Civil Guard and then secretly buried. The Final Report of the Comisión de la Verdad y Reconciliación (CVR) indicates that 1983 and 1984 were the most ferocious \HDUVRIWKHHQWLUHFRQÁLFW  2000), coming to a loss of life totaling a third of the victims of the entire period of violence. See Comisión de la Verdad y Reconciliación (CVR), Informe Final (Lima, 2003), vol. 1, chapter 3, p. 133. 11 Lama, “Pobre Goethe,” p. 63. 12 Personal correspondence with Sergio Zevallos. Lima, November 2013. 13 Boris Groys, “La condición poscomunista” (translation by Desiderio Navarro), Criterios, 2007, 15 January, 2014, http://www.criterios.es/pdf/ mondediplogroyscondicion.pdf Micro-groups The formation of Grupo Chaclacayo occurred at the same time as the unprecedented explosion of a counter-cultural VFHQHNQRZQDVWKH¶PRYLGDVXEWHUUiQHD·>WKHXQGHUJURXQGVFHQH@ZKLFKKDGEHJXQWRGHYHORSLQ/LPDDW the beginning of the eighties. These anarchist micro-communities of amateur creative production employed poetry, the visual arts, philosophy, music (initially rock, punk and hardcore that were fused in some cases with chicha and tropical rhythms). This included rock groups like Leuzemia, Narcosis, Zcuela Cerrada, Guerrilla Urbana, Autopsia; publications and alternative music magazines such as Macho Cabrío, Alternativa Subterránea, Luz Negra; the platforms for collective organization and participatory architecture works of Los Bestias (1984-1987); the underground scenographies and graphic production of Herbert Rodríguez, Alfredo Márquez and Jaime Higa, among others. These were collectives that gave shape to an effervescent moment of self-organized cultural production characterized by the crudity and strength of their languages and total GHQLDODQGUHMHFWLRQRIRIÀFLDOYLVXDOLW\DQGYDOXHV>ÀJ@9 The chaos, violence and social crisis that these experiences highlight intuitively in their songs, poems and images, translates as a genuine state of fatigue for a generation tired of the traditional political structures. Towards the end of the eighties the radicalization of the underground scene became a target of direct attacks and governmental repression that eventually resulted in the dissolution and fragmentation of these practices by the early 1990s. The beginning of the formation of Grupo Chaclacayo and other radical underground experiences like the Kloaka poetry movement (1982-1984), coincided with some of the most outrageous and atrocious assassinations, murders and massacres in the central Andes perpetuated by the armed forces and the Maoist organization Shining Path between 1983 and 1984.10 If Grupo Chaclacayo never established a direct relation with the “underground scene” –although certainly with Frido Martin who was related to the Kloaka Movement– both experiences were intimately connected because of the way in which they announced the body as a central protagonist in their YDULRXVHQXQFLDWLRQV,WLVVLJQLÀFDQWWKDW$OIUHGR0iUTXH] –one of the most active participants in the underground scene– and other members of the architecture collective Los Bestias can be spotted in a photograph of Grupo 14 See Luis Sánchez-Mellado, “La sexualidad es como las lenguas. Todos podemos aprender varias. Entrevista: Beatriz Preciado,” El País, Madrid, 13 June, 2010. 15 Sergio Zevallos, “Der Obszöne 7RG3HUX(LQHÀQVWHUH Gebärmutter für meine Bilder,” in Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin, Alexander Verlag, 1989). See English translation in the pages 140-141. 16 Helmut Psotta, “Die Koloniale Jesusbraut Rosa von Lima und die Korruption der weißen Kaste oder Eine lyrische Version europäischer Brutalität...,” in Grupo Chaclacayo, Todesbilder. Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin: Alexander Verlag, 1989), pp. 39-49. 17 Dorothee Hackenberg, “Dieser Brutälitat der Sanftheit. Interview mit Helmut J. Psotta, Raul Avellaneda, Sergio Zevallos von der Grupo &KDFODFD\REHU¶7RGHVELOGHU·µTAZ, Berlin, 26 January 1990, p. 22. (See English translation in the pages 144-147). In a 1921 text, German philosopher Walter Benjamin observes capitalism as a “religious phenomenon” whose development was decisively strengthened by Christianity: “Capitalism is purely cultic religion, without dogma. Capitalism &KDFODFD\R·VH[KLELWLRQLQVWDQGLQJQH[WRQHRIWKH SUHFDULRXVVFXOSWXUHVRQGLVSOD\>ÀJ@$OWKRXJKWKH\ never managed to work together, both moments of collective production (Grupo Chaclacayo and Los Bestias) are probably the most creative and radical experiments of the WLPH7KH\FDQEHFKDUDFWHUL]HGQRWRQO\E\WKHUHVLJQLÀ cation of debris and waste but above all by the clarity with which both assume that through the construction and of architectural and scenographic structures they could modify the behavior of bodies. It is here that their work becomes an intervention into the production of collective subjectivity. As the case with part of the underground scene since 1983-1984 onwards, Chaclacayo Group responded to the thousands of images of death and murder that were circulating in the press in a context in which destruction was not only a creative possibility but also an imminent social reality. ,WLVLQWHUHVWLQJWRREVHUYHWKHQDWXUHRIWKHÀUVW UHÁHFWLRQVDQGUHDFWLRQVIURPORFDODUWFULWLFVWRWKH exhibition at the Lima Art Museum. In the magazine Caretas, Luis Lama denounced the aesthetic excesses and political incorrectness of their bodies and works, labeling their art as a “null pseudo-art”, “an allegory of decadence”, “a dissection of degeneration”, employing “blasphemous paraphernalia” and “propagating a homosexual myth” in “an excessive pursuit of pathos”. The critic rejects the opportunity of engaging their images in an artistic debate and instead seeks to expose them to the scrutiny of the clinician or psychoanalyst, categorizing them as “perversions that are closer to Lacan that to Marx.”11 The indignation that these deviant bodies awoke for Lama is an early symptom of the threat that these queer grammars proposed for the continuation of the national social and heterosexual order. That these art works were occupying a museum, a space reserved for the modern art of the elite (masculine, white, clean and disciplined), was seen as increasingly dangerous. The title of the exhibition chosen by the group – Peru… un sueño>3HUX«$'UHDP@²ZDVDQDOOXVLRQWRWKH exotic representations of certain territories constructed by the touristic, colonial and Eurocentric gaze. Inspired by a graphic work by the Chilean artist Carlos Leppe, the group decided to make a poster for the exhibition parodying WRXULVPOHDÁHWV+RZHYHUWKHW\SLFDOLPDJHVRID¶SURPLVHG ODQG·ZHUHUHSODFHGE\SULVRQUHFRUGVFHPHWHULHVWRUWXUH and burials: here they reveal the country as an inverted image of the imperial dreams of European modernity, itself developed parasitically on Christianity in the West –not in Calvinism alone, but also, as must be shown, in the remaining orthodox Christian movements– in such a way that, in the end, its history is essentially the history of its parasites, of capitalism.” Walter Benjamin, “Capitalism as Religion” (trans. Chad Kautzer), in Eduardo Mendieta, ed. The Frankfurt School on Religion: Key Writings by the Major Thinkers (London, Routledge, 2005), p. 260. ing the clear link between his appropriation of Saint Rose and the political violence: “While Saint Rose VHOIÁDJHOODWHVDQGFDXVHVKHURZQ physical pain, in this country bodies are tortured and destroyed without apology.” Miguel Silvestre, “A propósito de una muestra de ¶&KDFODFD\R·&XDQGRHOVHUDXWpQ tico resulta ser peligroso,” El Diario Marka, Lima, November 27, 1984, p. 18. See English translation in the pages 138-139. 18 Zevallos, “Der Obszöne Tod.” 20 The “slaughter of the prisons” refers to the political repression and military event on the 18 and 19 of June, 1986, following a riot by prisoners accused of terrorism in 19 Sergio Zevallos referred to it in this way, see Dorothee Hackenberg, “Der Obszöne Tod,” p. 23. In an interview in 1984, Zevallos was highlight- which were imposed across the non-European world >ÀJ@12 The work in the exhibition and the title attempted to reveal how the colonial process of civilization and Westernization by means of evangelization throughout /DWLQ$PHULFD²DQGLQRWKHUSODFHVODEHOHGWKH¶7KLUG :RUOG·²LVOLQNHGGLUHFWO\WRWRWDOLWDULDQLVP Peru…A Dream could be interpreted from the present as a means of visibilizing and critically addressing WKHÀFWLRQRIWKHQDWLRQVWDWHDQGLWVYLROHQWGHPDQGVWR own identity. This is true even today: a moment when the defeat of communism as an internationalist political project and the disappearance of other post-national PRGHVRIVRFLDOLW\KDYHQDWXUDOL]HGWKHDUWLÀFLDOLW\RIWKH national states to the point of conver ting them into the “real protagonists of history”.137KHGLIÀFXOW\RILPDJLQLQJ models and social systems that unlearn the idea of nation continue to limit the capacity to imagine communities united through common political projects. One such community would be that disobedient multitude of un-classable sexual bodies: androgynous, transvestite, transgender, intersex, prostitutes and promiscuous, as well as a whole series of sick, crip and disabled bodies that share a history of pathologization. It is these subjects of the revolution that are evoked by the actions of the group. These nomadic micro-collectives are developing and rehearsing diverse strategic methodologies of alternative cultural and economic production that escape the fantasies of surveillance and total control of the State. Today it is necessary to learn from their alternative forms of relating politically and personally, which make a claim for the unfamiliar, for the non-national and for the non-gender.14 I am the bride of Christ Sergio Zevallos introduced the idea of working with the image of Saint Rose to Grupo Chaclacayo in 1982: the collages and drawings he made just before his departure from university intervened into the social and religious FROOHFWLYHPHPRU\RIZKRZDVNQRZQDV¶WKHEULGHRI &KULVW·DQGZDVWKHÀUVWEHDWLÀHG6DLQWRI$PHULFDRIWKH seventeenth century. In the series Estampas>3UD\HU&DUGV@ (1982), Zevallos took the traditional historical portraits of 6DLQW5RVHDQGPRGLÀHGWKHPLQREVFHQHZD\V,QWKHDUWLVW·V construction of a sadomasochistic landscape of incestuous DQGKRPRHURWLFIDQWDVLHVKHGHÀOHVWKHUHOLJLRXVGLVFRXUVHV of submission and parodies sacred mystical images. 24 various penitentiaries in Lima. The riot was created with the intent of capturing international media attention immediately before the XVII Congreso de la Internacional Socialista [18th Congress of the InternaWLRQDO6RFLDOLVW@ /LPD-XQH 1986), which was organized for the ÀUVWWLPHLQ/DWLQ$PHULFD7KLV slaughter was the greatest mass murder of the decade. 21 Achille Mbembe, “Necropolítica,” in Helena Chávez Mac Gregor, ed. Estética y violencia: necropolítica, militarización y vidas lloradas (México D.F: MUAC, 2012), p. 135. The collages and drawings of Zevallos reverse the racial and sexual authoritarianism that the living memory of colonization exercises over the body and makes visible a representation of Saint Rose at war where the historical “whitening” of her image (a product of her canonization) is devoured by repressed sexual desire and her mestizo origins. In another series from the same time entitled Rosas>5RVHV@  DQGQue tu carne es el cielo recién nacido  >&DXVH<RXU)OHVK,VWKH1HZ%RUQ6N\@ Zevallos presents variations made with carbon and chalk using a similar palette to the traditional portraits of Saint 5RVH,QWKHVHGUDZLQJVERGLHVRULÀFHVÁXLGVDQGZRXQGV construct orgiastic agglomerations of pleasure, pain, life and death. The images are the result of an obsessive repetition that delves into the savage, introducing us into a colorful and festive nightmare of annihilation. According to Zevallos, the drawings produced during those years –including the series Altares >$OWDUV@  DQGSangre y ceniza >%ORRGDQG$VKHV@  ²VRXJKWWREULQJWRJHWKHU the local religious myths and the “cult of national heroes, the Holy Tribunal of the Inquisition with their current equivalents: the institutions of torture, police interrogations, urban destruction of the ancient Andean funeral VLWHVWKHFODQGHVWLQHEXULDOVDQGWKHWUDIÀFNLQJRIYLFWLPV of political violence.”15 Another series of drawings that employs images of the Saint is the remarkable series Rosa Paraphrasen (1986) produced by Helmut Psotta. Here Psotta superimposes a portrait of his mother (also called Rose) onto an image of Saint Rose. Here he constructs an archive of sinister images of pain, desolation and anguish. Saint Rose (1586-1617) fervently venerated for her overwhelming spiritual devotion and her painful selfLQÁLFWHGFRUSRUHDOSXQLVKPHQWLVUHYHDOHGE\*UXSR Chaclacayo as an ambiguous symbol of how religious and state discourses associate pain and extreme suffering with the promise of happiness and well-being. Here they highlight the role of mystical images in the history of Western oppression.167KHEHDWLÀFDWLRQRI6DLQW5RVHRI Lima in Rome in 1668, and her canonization by Pope Clemente X in 1671, are interpreted by the group as one of WKH&KXUFK·VVWUDWHJLFJHVWXUHVGHSOR\HGWRFRQVROLGDWH its hierarchy and to proclaim the success of the processes of evangelization in the Americas. “That which used to happen through the Church now happens through the 22 Hackenberg, “Diese Brutälitat der Sanftheit,” p. 23. 23 Beatriz Preciado, “The Ocaña We Deserve: Campceptualism, Subordination and Performative Policies,” in Ocaña: 1973–1983: acciones, actuaciones, activismo (Barcelona: Institut de Cultura de O·$MXQWDPHQWGH%DUFHORQD  p. 421. 24 An important aspect to mention is the profuse circulation of images associated with the cult of the popular saint Sarita Colonia, which is present in the various artistic, poetic and musical production of the time – including in the work of the collective EPS Huayco (1980-1981). The tension between the countercultural appropriations of Sarita Colonia and the drag performances as Saint Rose of Lima by the Group Chaclacayo deserves an analysis beyond the limits of this essay. About the Sarita Colonia image, the left and popular culture see Roger Santivañez, “Sarita Colonia, la chicha y la izquierda nacional,” in Somos, magazine of El Comercio, Lima, 1983, p. 19. On the work of E.P.S. Huayco, see Gustavo Buntinx, ed. E.P.S. Huayco. Documentos (Lima, MALI, CCE e IFEA, 2005). 25 Some of these never-exhibited environments are described by art critic Gustavo Buntinx in “Una banks and the politicians,” signaled Psotta in 1990, alluding to the hidden alliances between Christianity and the politics of exploitation and violence that maintain a moral and economic order in which the sacred is always a fetish or a commodity.17 In La agonía de un mito maligno [The Agony of D0DOLJQDQW0\WK@ FD ²RQHRIWKHÀUVWFROOHFWLYH actions made under the direction of Psotta– the group WKHDWULFDOL]HVULWXDOVDFULÀFHVRQWKHVKRUHRIWKH3DFLÀF Ocean documented by photographer Piero Pereira. The photographs portray several characters covered with robes and hoods and gathered around a black tent where there are a series of half-buried dead bodies surrounded by candles. Here they emulate an obscure, silent wake of anonymous corpses: pre-Inca funerary bundles but also mass graves, indigenous cemeteries but also the death FDXVDOLWLHVRIWKH,QTXLVLWLRQ>ÀJ@,QRWKHUSKRWRJUDSKV LQWKHVHULHVWKHÀJXUHRIDWUDQVYHVWLWH6DLQW5RVHLV shown crossing a sandy section of land demarcated by EODFNÁDJVDQGFURVVHV/DWHUWKHFKDUDFWHUIDOOVGHVWUR\HG and dying into the arms of another character: a scene that references the Pieta by the Renaissance artist Michelangelo. An imaginary of transvestite saints and virgins is expanded in Suburbios>6XEXUEV@  SHUIRUPHGE\ Zevallos and the poet Frido Martin in collaboration with a street photographer. As a change from the other projects of the group, this series of photographs was produced in the public space of the city –old houses, the façade of a school, abandoned parks, among others. The images present a ritualistic choreography of two androgynous, transvestite bodies that rummage around in the cruelty of Christian iconography. As if they were engaged in a devotional rapture, both bodies stage episodes of torture, FUXFLÀ[LRQDQGGHDWKDVZHOODVSOHDVXUHHURWLFLVPDQG ecstasy. The series of works, originally entitled Pasiones de un cuerpo ambulante>3DVVLRQVRIDZDQGHULQJERG\@ converts the visual vocabulary of martyrdom into a social autopsy. They demonstrate how the effort that goes into purifying the soul comes from the same place as the most atrocious gestures of destruction of the body. This series, which also borrows from a baroque religious imaginary, SRSXODUFXOWXUHDQGSRUQRJUDSK\>ÀJÀJ@LV described by Zevallos as “a macabre dance surrounded by ruins” where “the naked body (bound by bandages and personifying the impotence and absence of shame before experiencia extrema en nuestro arte,” Caballo Rojo, supplement of El Diario de Marka, Lima, 28 March, 1983, p. 10. 26 “In Berlin I realize how the healthy concern about Peru go often hand in hand with distortion. (...) Returning to West Berlin I decide to see if I could lose myself in the city EXWEHIRUH,JRWRWKH>.QVWOHUKDXV@ Bethanien to met the director, Dr. Haerdter. He shows me the luxurious catalogue of its next attraction: None other than the terrible guys of Grupo Chaclacayo, who just arrived from a flashy tour that mixed in the same bag castration and crucifixions, blasphemy and pene- trations, murders –committed by the Armed Forces of Peru, of course– and liberations. All in a thick ideological-sadomasochistic concoction that is so excessive that only the naive ones could swallow that pill. Five years ago the political position of the Grupo Chaclacayo was reduced to a sort of homosexual black mass, with explicit description of perversions WKDWDWWHPSWHGWRVXEYHUW/LPD·V habits in a city where vice does not shock nor virtue dazzles. Now in Germany, led by Herr Psotta, the German leader, and facing a new clientele, the proposal has radicalized in an evident desire to denounce repression and political murder (sic). For these purposes the catalo- the abandoned) appears as a delicate statue atop cold stone in the middle of a storm”.18 In another action, made as a response to the evidence of terrible massacres during the war, the painful punishments on the body of Saint Rose serve as an explicit analogy of the sordidness of the governmental politics of extermination masked in religious devotion, which permits WKHPWRDSSHDU¶FOHDQIDFHG·DIWHUFRPPLWWLQJWKHPRVW criminal atrocities.19 In the series of photographs Rose Cordis (1986), made by Zevallos again in collaboration with Martin, a character in drag with a black tunic and a crown of roses applies make-up, then masturbates at the side of what seems to be a dead body in a cubicle dyed red and covered with Playboy clippings. In the following image, the VDLQWFKDQJHVLQWRDWRUWXRXVKRRGHGÀJXUHWKDWVRGRPL]HV the corpse. Rose Cordis was a reaction to governmental actions such as the prestigious decoration of the Order of the Sun to Saint Rose for the 400th anniversary of her ELUWKMXVWDIHZZHHNVEHIRUHWKHYLFLRXV¶VODXJKWHURIWKH SULVRQV·20 This public ceremony, lead by the governmental authorities, was a liturgy that Grupo Chaclacayo interpreted as a means for the political and military elite to disguise their participation in the war. Corpses The works of the group were intended to make visible how false notions of sovereignty and state governmentality serve to exercise violence on those that put in danger the apparent legitimacy of the state. These mechanisms of exclusion are prisons and hospitals as well as the massacres and genocide carried out by the military, who appear time and time again in their works as a way for interrogating the totalitarian forms of administration of death in contemporary life. This “generalized instrumentalization of human existence and the material destruction of bodies and SRSXODWLRQVMXGJHGDVGLVSRVDEOHDQGVXSHUÁXRXVµLVDV the philosopher Achille Mbembe has shown, what made death the main apparatus of political domination beginning in colonial times. Death becomes, then, the main motor of modernity and today the most effective oil of the capitalist machine.21 To stage the colonial European fantasies through their sinister underside, through the corpse –the residue of the non-representability of death– Grupo Chaclacayo accurately equated the promises of Western progress with gue includes known testimonies as photos of massacres –committed by military– and a chronology that, to say the least, it is biased. New collaborators has joined, as Mrs. Sybilla Arredondo, who has kindly JUDQWHG>UHSURGXFWLRQULJKWVRID@WH[W by Jose María Arguedas. This text has been included among others, as the one written by Psotta himself, who elaborates on the scope of corruption. He undoubtedly must be an expert of the subject: he reduced terrorist murder in a Freudian necrophiliac allegory in which sex, blood and shit joint together to cause terror”. Luis Lama, “Perversión y complacencia”, Caretas, Lima, 20 November 1989, p. 74-76. human remains that nobody wants to see. These are the nameless remains of the economies of war and occupaWLRQ,QPDQ\RI=HYDOORV·ZRUNVYLVXDOPDUNHUVOLNHEODFN ÁDJVSODFHGRYHUWKHH\HVRIXQGHUDJHYLFWLPVRISROLFH brutality are used in drawings portraying massacred ERGLHVLQSHUPDQHQWDJRQ\>ÀJ²ÀJ@,QRWKHUZRUNV LWLVSUHFLVHO\WKHUHOLJLRXVÀJXUHVVXFKDVWKHVLOKRXHWWH of Beatita de Humay (the humble Luisa de la Torre, born in the Ica region in Peru in 1819, who was revered and UHVSHFWHGIRUKHUSRZHUVWRKHDODQ\GLVHDVHRUDIÁLFWLRQ  that are converted into sinister, shadowy characters always portrayed beside hurt, tortured or buried bodies >ÀJ²ÀJ@ These images are also a visceral reaction to the FRQVWDQW¶VWDWHRIHPHUJHQF\·GHFODUHGE\WKH3HUXYLDQ JRYHUQPHQWLQWKHFRQWH[WRIDQLQFHVVDQWDUPHGFRQÁLFW /LNHPDQ\RWKHUPRPHQWVLQKLVWRU\WKLVH[WHQGHG¶VWDWH RIH[FHSWLRQ·VHUYHGWROHJLWLPDWHUHSUHVVLRQSROLWLFDO persecution and illegal assassinations, all of which were implemented as a counter military strategy and applied mainly against communities of Quechua speakers indigenous of the central Andes region. It was among these communities and in these regions that the largest number of mass graves have been discovered since 1983. It is precisely the image of the mass grave –thousands of tortured bodies, buried secretly– that presents a whole macabre genealogy of barbarity, where the techniques of disappearance and strategies of extermination have never ceased to become more sophisticated >ÀJ@7KHDOOXVLRQLQWKHZRUNRIWKHJURXSWRWKLVLQYHQtory of corpses was an exercise in recognizing the links between the concentration camps of Nazi Germany, the civil wars in Europe, the military machine of Operation Condor, the clandestine detention centers of the South American dictators and the devastating consequences of WKH0DRLVWSHRSOH·VZDULQ3HUX´:KHQDERRNE\0DU[ or Marcuse was found in the University of San Marcos one ZDVLPPHGLDWHO\WRUWXUHG¶GLVDSSHDUHG·RUDVVDVVLQDWHG This is just one example of the results of the European dream, something that Marx could probably never have imagined,” said Psotta in 1990 problematizing the situation that the emancipatory discourses of European modernity had for non-Western contexts.22 However, the appearance of the transvestite burials, queer bundles and mummies in his work suggests an unrecognized, underground and unnoticed war: this is 26 27 the war declared against homosexual, effeminate, weird, XJO\DQGPRQVWURXVERGLHV>ÀJ@7KHVRFLDOSOHDVXUH that the death of homosexuals and the annihilation of sexually dissident bodies produced, emerges in their work as a means of twisting the traditional and prevailing hypotheses UHJDUGLQJWKHRULJLQVRIWKHDUPHGFRQÁLFWLQ3HUX&RQWUDU\ to the prevailing hypotheses, Grupo Chaclacayo locate one of the origins of political violence in ideas of able-bodied heteronormativity, which are integral to the maintenance of the declared war against any subject disobeying the hegePRQLFUHJLPHVRIWKH¶QRUPDO·DQGDJDLQVWWKRVHERGLHV that are not useful for the productive demands of capitalism – the zero-positives, the disabled, the transgender, the migrants without papers, among others. ,QRQHRIWKHPRVWVLJQLÀFDQWVHULHVRIZRUNVHQ titled Sangre y ceniza. Variaciones sobre la bandera [Blood DQG$VK9DULDWLRQVRQWKH)ODJ@  =HYDOORVUHYLOHV WKHLPDJHRIWKH3HUXYLDQÁDJLQDFROOHFWLRQRIGUDZLQJV where bodies without heads, arms or legs, are confused with scenes of bleeding debauchery, sadomasochism and anal penetration. The drawings explode skin without mercy, destroying in their wake any notion of heroic history: in WKLVÁDJWKHUHLVQRWKLQJWRFHOHEUDWHEH\RQGWKHWUDFHV of murder, domination and castration. The pan-sexual GHVHFUDWLRQRIWKHÁDJDQQLKLODWHVWKHKHWHURVH[XDOLPpulse of the reproduction of the nation, obliging us to feel WKH QDWLRQDO ERG\WKURXJKLWVUHSUHVVHGRULÀFHVDQG restore a primitive paganism that dismantles the racist and homophobic patriotism: two of the pillars of the modern nation-state. This proliferation of queer corpses can also be read as an allusion to the processes of social cleansing that paired homosexuality with death, promiscuity with criminality and ultimately served to delegitimize non-monogamous or non-normative sexualities. This is something that was reinforced with renewed vigor in the eighties, when the AIDS crisis propelled the development of new forms of governing the body that revived violent forms of persecuting those disobeying gender in the public sphere. Semen and gunpowder The actions and representations of Sergio Zevallos on the subject of queer religiosity are an attempt to revive the stories of androgynous devotion and transvestite rituals that have been constantly suppressed throughout history. The use of Catholic imagery by Zevallos exalts the cheap forms of visual representation and social consumption of local virgins and saints, establishing operations of selfLGHQWLÀFDWLRQZLWKSRSXODUDQGOXPSHQFXOWXUH HYHU\WKLQJ considered poor and vulgar from the urban, upper-class perspective), which the group interspersed with images of prosthetic limbs, crosses, portraits of children, blood, mangled bodies, gunpowder, and semen, proposing a renewed space of political antagonism.23 The images are a staging similar to what queer theorist Beatriz Preciado has described as the “unspeakable attraction between the soldier and the queer, between the dyke and the queen, between the cop and the whore, between the artist and the illiterate, between the aesthetic of the martyrs and sadomasochistic sexual culture.”24 These queer forms of theatricalizing power and of resignifying religious morality can be related to a wide repertoire of Latin American sexual disobediences and pagan feasts, which have rarely been shown and discussed. For instance, the drawings of phallus-altars for the Virgin of Guadalupe by the Mexican feminist Mónica Mayer in the late 1970s; the feminist religious posters and stickers printed with prayers for abortion rights and freely distributed by the Argentine collective Mujeres Públicas [Public :RPHQ@WKHOLWXUJLFDOH[SHULHQFHVDQGVXEYHUVLYHDFWLRQV RIWKH&KLOHDQGXR<HJXDVGHO$SRFDOLSVLVGXULQJ3LQRFKHW·V dictatorship; the numerous homoerotic self-portraits with Catholic iconography by Mexican painter Nahum Zenil; the UHFHQWVWUHHWSLOJULPDJHVRI&KLOH·VÀUVWWUDQVVDLQW.DURO Romanoff, organized by the Coordinadora Universitaria de Disidencia Sexual [University Coordinator of Sexual DissiGHQFH@ &8'6 DQGWKHVXUUHSWLWLRXVSXEOLFDSSHDUDQFHV of Peruvian drag queen Giuseppe Campuzano as an Andean Virgin, among many others. This large combination of sexual-political resistances positioned against the disciplinary system of sexual difference and its notions of normality does not DGYRFDWHIRUDQ¶LQFOXVLRQ·LQWRWKHYDOXHVRIWKHPDMRULW\ but rather demands a radical transformation of certain systems of meaning and social structures that label nonQRUPDWLYHERGLHVDV¶GLVRUGHUHG·,QWKDWVHQVHYDULRXV works by Grupo Chaclacayo attacked Catholic traditional family models. In some early funeral environments, Raul Avellaneda deploys his personal and family portraits to comment sexual violence and racial discrimination faced during childhood in a daily basis.25 Avellaneda produced assemblages, drawings and objects –such as the major series Letanías Acalladas>6LOHQFHG/LWDQLHV@ (1984-1988) and the photo series of staged domestic scenarios (1986)– where the castrated body and the repressed identities breaks free to imagine an abject and perverse renewed poetic order. The political potential of these practices resides precisely in their capacity to fracture a collective understanding of what the desired social body should be. In the series Ambulantes>:DQGHUHUV@  Detritus (1986) or Algunas tentativas de la Inmaculada Concepción >$)HZ$WWHPSWVDERXWWKH,PPDFXODWH&RQFHSWLRQ@ (1986), Zevallos has explored other forms of sociality, sexuality, affect, eroticism between the living and the LQDQLPDWHEHWZHHQWKHDUWLÀFLDODQGWKHKXPDQ+LV images register entities in states of permanent displacement: transgender, hermaphrodite, migrant, intersex and tramp. To return to the public sphere that which has been expelled and marked out as abnormal or sick, is an operation that widens the boundaries of the public in a process where those bodies who have been denied the status of human acquire, through other means, the possibility to be subjects of enunciation and political agents of knowledge production. For Zevallos it is transvestism –inasmuch as it GLVRUJDQL]HVDSSURSULDWHVDQG¶PLVTXRWHV·FXOWXUDOFRGHV² that is the privileged operation for denaturalizing power, subverting hierarchies and resignifying a political history of the body. His images are toxic exorcisms launched as projections against a social memory. Firstly, they seek to liberate a collective imaginary from the totalitarian spell through the creation of obscene representations of disobedience that allow us to keep breathing in the face of heteronormative culture. Secondly, they inhabit shame, infection, toxicity, and illness, as a way of deactivating categories of social exclusion. This counter-sexual production of the body powerfully dismantles a whole system that FRQÀQHVDQGUHJXODWHVWKHVHIRUPVRIJHQGHUGLVVLGHQFH These performativities are also a call to imagine new social contracts and models of political action that emerge form the abnormal, from the multiple and from the vulnerable. It is not surprising that the reading of this experience advanced by certain critics, who asserted that these bodies required psychiatric rehabilitation, continued WRKRXQGWKHJURXS·VKRPRHURWLFDUWLVWLFJUDPPDU,Q a 1989 article, the art critic Luis Lama (who had rebuked their work on moral grounds in 1984) dismissed the JURXS·VZRUNWKHQH[KLELWHGDWWKH.QVWOHUKDXV%HWKDQLHQ in Berlin, accusing it of being “shrill and frivolous apologies” for Shining Path.26 Beyond the threat that such accusation entailed for artists (at the time, it could mean persecution, kidnapping, torture, or forced disappearance), it is revealing how these anarcho-queer outbreaks were DVVRFLDWHGZLWKWKHWHUURUSURGXFHGE\WKH6KLQLQJ3DWK·V armed raids in Peru. /DPD·VGHQXQFLDWLRQUHSUHVHQWVDSRZHUIXOH[DPSOH RIKRZWKHJURXS·VLQDSSURSULDWHH[SUHVVLRQVRIVH[XDOLW\ were interpreted as a threat to the national body and its ERXQGDULHV(TXDWLQJ¶WHUURULVWV·ZLWK¶TXHHUV·KRZHYHU subtly, was an example of how this hyper-sexualized WKHDWULFDOLW\DQGFULSSOHKRPRVH[XDOÀFWLRQWKDWEOHQGHG the soldier and the priest, the child and the corpse, could be a metaphor just as explosive and threatening to the social body as the murderous Shining Path group. Translated by Rebecca Close Miguel A. López (Lima, 1983) Migrant. He is writer, artist and researcher whose interest lies at the intersection of visual culture, gender, sexuality and politics. He has published his writing in periodicals such as Afterall, ramona, Manifesta Journal, (ÁX[-RXUQDO, Art in America, The Exhibitionist, and Art Nexus, among others. Among his recent publications are: Giuseppe Campuzano. Saturday Night Thriller y otros escritos, 1998-2013 (2013) a collection of writings by the transvestite philosopher Giuseppe Campuzano; ¿Y qué si la democracia ocurre? (2012, co-edited with Eliana Otta) a book on visuality, politics, and democracy; a comprehensive catalogue on Peruvian conceptual artist Teresa Burga (2011, with Emilio Tarazona); and a queer issue of Argentine ramona magazine (2010, co-edited with Fernando Davis). His most recent curatorial projects include Losing the Human Form. A seismic image of Latin America in the 1980s, curated within Red Conceptualismos del Sur, MNCARS, Madrid, 2012-2013, and Altered Pulse, co-curated with Sol Henaro, MUAC-UNAM, Mexico, 2013-2014. He is currently working on curatorial projects related to drag performances and popular culture for Utopian Pulse exhibition in Secession in Vienna (2014), and for 31ª Sao Paulo Biennial How to talk about things that don’t exist (2014). 28 29 La frialdad del éxtasis Fernanda Carvajal Cold Ecstasy 30 Fig. 20 Marcha de travestis en la Plaza de Armas de Santiago. Portada del diario Clarín, Santiago de Chile, martes 24 de abril de 1973. Archivo Biblioteca Nacional de Chile. 31 Fig. 21 Portada del diario Expreso, Lima, 6 de diciembre de 1978. Fig. 25 Juan Dávila [registro de Martin Munz], La Biblia de María y Liberación del deseo = Liberación social, ca.1982, fotografía a color sobre papel brillante, 120 x 80 cm. Colección Museo de Arte Contemporáneo (MAC), Universidad de Chile. Foto: Jorge Marin. Gentileza MAC. © Juan Davila, Cortesía Kalli Rolfe Contemporary Art. Fig. 23 Portada del diario La República, Lima, 31 de enero 1983. Archivo Sergio Zevallos. Fig. 22 Portada de la revista Hoy, Santiago de Chile, año II, N°81 (13 – 19 de diciembre de 1978). Cortesía del Centro de Documentación del Museo de la Memoria y los Derechos Humanos de Chile. Fig. 27 Sergio Zevallos (Grupo Chaclacayo), de la serie Detritus, 1986. Inyección de tinta sobre papel Hahnemühle. 37 x 50 cm. Fig. 24 Sergio Zevallos (Grupo Chaclacayo), de la serie Algunas tentativas sobre la Inmaculada Concepción I, 1986. Inyección de tinta sobre papel Hahnemühle. 50 x 37 cm. Fig. 26 Sergio Zevallos (Grupo Chaclacayo), de la serie Rosa Cordis, 1986. Inyección de tinta sobre papel Hahnemühle. 50 x 37 cm. 32 33 1 Tomado de las notas del artista sobre la serie Suburbios (1983). Zevallos llama a estas notas los ‘guiones’ de la serie. 2 Así las denomina la nota “Ostentación de sus desviaciones sexuales hicieron los maracos en la Plaza de Armas,” El Clarín, Santiago de Chile, 24 de abril de 1973. 3 Véase “El tercer sexo en el primer poder,” Oiga, Lima, 11 de diciembre de 1978. [Nota del editor: Los travestis demandaban a la Comisión de Derechos Humanos del Congreso la inclusión de un apartado donde se explicite más o menos lo siguiente: “Toda persona tiene derecho a la vida, a la integridad física y al libre desenvolvimiento de su personalidad. Nadie, en ningún caso, por su comportamiento sexual, puede ser sometido a torturas ni penas o tratos inhumanos, humillantes o discriminatorios, pues merece todo el respeto y consideración a que tiene derecho cualquier persona.”] 5 Pablo Oyarzún, “La omisión del pronombre,” The Clinic, Santiago de Chile, 10 de septiembre de 2013. 4 Felipe Rivas, “Travestismos,” en Red Conceptualismos del Sur, eds. Perder la forma humana. Una imagen sísmica de los años ochenta en América Latina (Madrid, MNCARS, 2012), p.247-253. Y el vientre de los maricas, velados de rosas verdaderas. Sergio Zevallos1 Fig. 29 Helmut J. Psotta (Grupo Chaclacayo), La agonía de un mito maligno, ca. 1982-1983. Participan: Sergio Zevallos, Raúl Avellaneda, Frido Martin. Fotografía: Piero Pereira. Tomado de Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin, Alexander Verlag, 1989), p. 25. Fig. 28 Sergio Zevallos (Grupo Chaclacayo), de la serie Detritus, 1986. Inyección de tinta sobre papel Hahnemühle. 37 x 50 cm. Fig. 30 Colectivo Yeguas del Apocalipsis (Francisco Casas y Pedro Lemebel), video de la performance Homenaje a Sebastián Acevedo, Concepción, 1991. Cortesía Pedro Montes y D21 Proyectos de Arte, Santiago de Chile. Fig. 31 Sergio Zevallos (Grupo Chaclacayo), Entierro de cal, ca. 19861987. Archivo Sergio Zevallos. En Perú como en Chile, la primera promesa, errática y fugaz, de una revuelta sexo-disidente, irrumpe en el espacio público en la antesala del terror impulsada por travestis prostibulares. Es decir, por sexualidades ilegalizadas que necesitan de la revolución para su supervivencia, y no por movimientos gays constituidos. Por un lado, la concentración de “yeguas sueltas y locas perdidas”2 en la Plaza de Armas en Santiago de Chile meses antes del golpe de Estado de septiembre de >ÀJ@3RURWURHQ/LPDHOJUXSRGHWUDYHVWLVTXHGHMDLQVFULWDVXSURWHVWDPDULFDVLPXOWi neamente en la calle y el burdel, marchando hacia el Congreso para pedir un trato sin discriminación en los momentos en que se formaba en el Perú la Asamblea Constituyente de 1978, y convocando SRUODVQRFKHVDOHVSHFWiFXOR´7UDYHVWLVHQOD3URVWLWX\HQWHµHQXQWHDWURORFDO>ÀJ@3 Acciones que, en cada contexto, aparecen como algunos de los primeros gestos colectivos de desacato frente DODVXMHFLyQFRORQLDO\KHWHURFDSLWDOLVWDTXHRSULPHORVGHVHRV\ORVFXHUSRV (OWUDYHVWLHVODÀJXUDWiFWLFDTXHVHUYLUiSDUDWUD]DUXQGLiORJRHQWUHODVH[SHULHQFLDV de disidencia sexual que irrumpieron en la escena cultural peruana y chilena durante los años RFKHQWD'HFLUWUDYHVWLHVQRPEUDUSULPHURXQDUHDOLGDGELRJUiÀFD\VRFLDOXQVXMHWRPDUFDGRSRU ODVXEDOWHUQLGDGGHFODVH\XQGHVDMXVWHFRUSRUDOTXHORGHMDH[SXHVWRDODSUHFDULHGDGHFRQyPLFD y a la violencia transfóbica y machista. Recientemente el artista y activista chileno Felipe Rivas advirtió que el término travesti siempre debería articularse en plural, para descentrar una y otra vez su tentación de aglomerarse en una sola identidad.4 Diremos entonces travestismos: travestisPRVGHOVXUFX\RVDUWLÀFLRVVXHOHQSURGXFLUXQOXMREDUURFRGHVGHODGHVSRVHVLyQTXHDQWHODFDUHQ FLDGHDGRUQRVDUPDQVXDUWLÀFLRDSDUWLUGHODUHWyULFDJHVWXDOGHODSUHQGDUHFLFODGDGHVGHHO desperdicio. Este término en plural no designa una nueva identidad que viene a sumarse a la larga OLVWDGHLGHQWLGDGHVH[LVWHQWHVVLQRTXHIXQFLRQDFRPRXQDRSHUDFLyQTXHH[KLEHHOFRQÁLFWRHQWUH los sexos y a la vez sugiere otra clase de guerras, otras cruzadas. Pienso en los años del terror en Chile y en Perú, en el modo en que la exhibición o sustracción del cuerpo –o más precisamente: del cadáver– formó parte de la gestión del poder. En Chile, en plena dictadura militar, el terrorismo de Estado administró el control de la población a través una estrategia calculada de secuestro, tortura y desaparición sistemática de los cuerpos, negando la existencia de los centros clandestinos de detención, esos “espacios secretos donde VHSUHSDUDEDXQD\RWUDYH]ORDWUR]µ>ÀJ@5 En cambio, en el Perú, el poder de muerte estaba H[SXHVWR\HUDHMHUFLGREDMRODDWHQWDPLUDGDGHODPDTXLQDULDPHGLiWLFD/DGRPLQDFLyQVH HMHUFLyDWUDYpVGHXQDWHFQRORJtDSRUQRJUiÀFDTXHÀMyHORMRVREUHODSUHVHQFLDH[DFHUEDGD\ espectacular del cadáver, de cuerpos calcinados, abiertos, mutilados, producto de un estado de guerra interna en la que dos bandos (Sendero Luminoso y el Estado Peruano) libraban una batalla principalmente en territorios de la población campesina e indígena (“el 94% de víctimas civiles 34 6 Grupo Chaclacayo, “Eine Zusammenfassung von Ereignissen, Repressionen und politischen Morden, die während der Arbeit am 3URMHNW¶3HUX«HLQ7UDXP·²*UXSR Chaclacayo – geschahen,” en Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlín, Alexander Verlag, 1989), p. 96 -101. 8 Como señala Oyarzún: “Como desnudez y desvelo, el vestido que vela \UHYHODMXHJDLQHYLWDEOHPHQWHDOD verdad. Revestirse de una apariencia que desnuda, o sea, travestirse, es develar la verdad, la del deseo: seducir.” Pablo Oyarzún, Arte, visualidad e historia (Santiago de Chile, Editorial la blanca montaña, 1999), p. 274. 7 Severo Sarduy, Ensayos generales sobre el barroco (Buenos Aires, Fondo de Cultura Económica, 1987), p. 93. 9 Carlos Pérez, “De la pintada promiscuidad,” en El fulgor de lo obsceno (Santiago de Chile, Francisco Zegers Editor, 1989), p. 46. son indígenas” –anota el Grupo Chaclacayo en su cronología de hitos sobre el Perú en los años RFKHQWD >ÀJ@.6 ¢(VSRVLEOHTXHHQVXMXHJRGHH[KLELFLRQHV\RFXOWDPLHQWRVHOWUDYHVWLDSUHQGD\UHWUXTXH algo de estos regímenes de visibilidad a través de los cuales se gestiona el poder? (OMXHJRGHOWUDYHVWLHVXQMXHJRGHYHORVGHGHVHRVYHODGRV(QHOWUDYHVWLel vestido es el primer velo que oculta y desnuda a la vez. Los pliegues de la falda encubren el secreto a voces de ¶ODVSDUWHVEDMDV·GHOWUDYHVWLVXDUWLÀFLRÀJXUDODFDVWUDFLyQ\DODYH]ODQLHJD´ODHUHFFLyQHVRPQLSUHsente, aún en la blandura de las telas, en su suavidad”.7 Se trata de producir una apariencia que oculta y a la vez desviste, una apariencia lasciva, que revela (sobre todo a quien mira) su deseo. El travesti apela a nuestro deseo, no a nuestra credibilidad: travestirse es seducir8 \HMHUFHUDVtXQSRGHU Las prácticas de travestismo chileno cumplen rigurosamente esa lógica del vestido: XQDIDOGDTXHQRFXEUHVLQRTXHGHVQXGD3HQVHPRVSRUHMHPSORHQODVIDOGDVGHODSHUIRUPDQFH y fotografía Las dos Fridas (1990) del dúo Yeguas del Apocalipsis (Pedro Lemebel y Francisco Casas). En esta acción, realizada en la Galería Bucci, los artistas representan un tableaux vivant del cuadro Las dos Fridas (1939) de la artista mexicana Frida Kahlo, en donde ambos aparecen con faldas y el torso desnudo y pintado. Allí, la operación travesti hace explícita la “línea ecuatorial de la cintura”9 la frontera entre la parte de arriba, el torso masculino desvestido e intervenido con SLQWXUD\ODSDUWHGHDEDMRFXELHUWD\FRQIXQGLGDSRUORVSOLHJXHVGHODIDOGD10 simulando ambos FXHUSRVXQDWUDQVIXVLyQVDQJXtQHD/HPHEHO\&DVDVMXHJDQDWUD]DUODJHRJUDItDGHOSRGHUHQVX propio cuerpo. Si la cintura sirve para marcar una división entre “las actividades de (…) arriba, FRPRODVGHODERFD\ODPLUDGD HO1RUWHLQGXVWULRVRGHOFXHUSR GHODVGHDEDMRFRPRODVGHODQR y los genitales (el Sur sórdido y venido a menos)”,11 en el contexto de la crisis y expansión del SIDA de los años 80 aquella división –que es también un dispositivo de control– se reorganiza de forma aún más violenta sobre los cuerpos colonizados y racializados. Lemebel y Casas invierten en su SHUIRUPDQFHHVDVMHUDUTXtDVXELFDQGRHQ´ODSDUWHGHDUULEDµ HQHO1RUWH HOFDQDOGHWUDQVPLVLyQ GHOFRQWDJLRFRQXQDVRQGDDELHUWDTXHÀOWUDJRWDVGHVDQJUHFRPRmanchas en la falda, esparciendo el estigma sobre el Sur. En otra acción del dúo Yeguas del Apocalipsis, titulada Casa Particular (1989), los artisWDVHVFHQLÀFDQOD~OWLPDFHQDFULVWLDQDMXQWRDWUDYHVWLVSURVWLEXODUHVGHOEDUULR6DQ&DPLOR/DPDGDPD del burdel, sentada al centro de la mesa, asume la pose de Cristo pero también el papel del dictador (Pinochet), diciendo: “Esta es la última cena de San Camilo, la última cena de este gobierno”. Luego de ofrecer pan y vino continúa: “este es mi cuerpo, esta es mi sangre”. La escena involucra a las traYHVWLVHQXQDUHWyULFDFULVWROyJLFDVDFULÀFLDOHQWDQWRTXH¶FXHUSRVHQWUHJDGRV·H[SXHVWRVDO6,'$ DODSUHFDULHGDGHFRQyPLFDDODVHVLQDWR6HWUDWDGHODGHFODUDFLyQGHXQÀQDO GHODGLFWDGXUDGHO SURVWtEXOR HQODTXHDTXHOORVFXHUSRVWUDQVJpQHURHVFHQLÀFDQODFRQYLYHQFLDHQWUHHOPHVLDQLVPR católico y el autoritarismo militar. Casa Particular es una parodia del estado dictatorial (y de su instauración de la hegemonía neoliberal) como un estado proxeneta. 35 10 Esto también lo apunta el crítico chileno Justo Pastor Mellado. Véase Justo Pastor Mellado, “El verbo hecho carne. De la vanguardia genital a la homofobia blanda en la plástica chilena,” en Juan Vicente Aliaga, ed. En todas partes. Politicas de la diversidad sexual en el arte (Santiago de Compostela: CGAC, 2009), p. 88.. 11 Carlos Perez, “De la pintada promiscuidad,” p. 46. 12 Comunicación personal de Sergio Zevallos, 19 de septiembre, 2013. 13 Entrevista con Sergio Zevallos, Lima, 25 de noviembre de 2013. 14 María Lugones, “Colonialidad y género. Hacia un feminismo decolonial,” en Género y decolonialidad (Buenos Aires, Ediciones del signo, 2008). 15 Señala Lugones que los miedos sexuales de los colonizadores “los llevaron a imaginar que los indígenas de las Américas eran hermafroditas o intersexuales.” Y luego agrega: “si el capitalismo global eurocenWUDGRVRORUHFRQRFLyHOGLPRUÀVPR VH[XDOHQWUHKRPEUHV\PXMHUHV blancos/as y burgueses/as, no es cierto entonces que la división sexual está basada en la biología.” Lugones, “Colonialidad y género,” pp. 30-31. (VWDMHUDUTXtDFREUDQXHYDYLJHQcia en la contemporaneidad con las redes de trata de personas que capWDQDPLJUDQWHV\PXMHUHVUHGXFLpQGRODVDOWUDEDMRHVFODYR\ODYLROHQFLD sexual. El modo en que el cuerpo travesti hace aquí una arqueología del poder se emparenta FRQODPDQHUDHQTXHODÀJXUDGH6DQWD5RVDWUDYHVWLGDDSDUHFHHQODREUDGH6HUJLR=HYDOORV3HUR si en las prácticas de disidencia sexual chilenas la violencia no es explícita, quedando eludida en la parodia, entre los pliegues del vestido, manteniéndose en el registro del secreto, en las obras de =HYDOORVKD\SRUHOFRQWUDULRXQDWHDWUDOL]DFLyQDELHUWDGHORSRUQRJUiÀFR=HYDOORVGHVSOLHJDXQ travestismo sin vestido, un travestismo construido con indiciosGHLQGXPHQWDULDIHPHQLQD³HQFDMHV negligés, ropa interior—, prendas mínimas “usadas como velos”12TXHGHMDQHOVH[RPDVFXOLQRH[SXHVto: como si el pene no estuviera nunca más oculto que cuando no se lo oculta. El velo en tanto fetiche devela ahí ocultando, por señalización e insistencia. En sus imágenes, la exhibición del placer con el cadáver, la masturbación gore, la penetración de los restos, replican y subrayan un particular régimen de producción de visibilidad de los cuerpos a través del cual el terror era entonces propagado HQHO3HU~>ÀJ@ II. Es curioso cómo en la repartición de roles, en la negociación de poderes y de posiciones la perspectiva masculina trata de diferenciar calidades de energías, de repartirlas y administrarlas, y cómo en el origen de eso está la Iglesia Católica y el cristianismo, que promueven esa división racionalista de las subjetividades y de las energías construyendo ideológicamente al enemigo, al peligro, como esa parte de la energía que está encarnada por la seducción. Sergio Zevallos13 (QORVSDtVHVGHOVXUHOQXGRDSDUWLUGHOFXDOVHLPSRQHQ\DGMXGLFDQORVUROHV\SUiFWLFDVPDVFXOLQDV y femeninas, asignando diferencialmente las potencias de racionalidad y seducción, de la agresividad y del cuidado, puede rastrearse en la matriz colonial del género.14 Ésta presupone una serie de relaciones de poder que ocurren en la intersección entre el género y la raza que tendrían un lado visible/ FODURTXHFRQVWUX\HODVQRFLRQHVKHJHPyQLFDVGHKRPEUH\PXMHU EODQFRV HQWRUQRDODQRUPDKHWH URVH[XDOHOSDWULDUFDGR\HOGLPRUÀVPRVH[XDO\WDPELpQXQODGRRFXOWRRVFXURTXHWUDVOD¶FRQTXLVWD· de América relegaría a aquellas personas de rasgos no-blancos y que “no fueron necesariamente HQWHQGLGRVHQWpUPLQRVGLPyUÀFRVµ15DVHUFRQÀQDGDVDODDQLPDOLGDGDOVH[RIRU]DGRFRQORVFROR QL]DGRUHV\DXQDH[SORWDFLyQDEXVLYDGHVXIXHU]DGHWUDEDMR16 Preguntarse por el modo en que estas dicotomías se imponen y consolidan culturalmente revela cómo la raza y el género no son cateJRUtDVWUDQVKLVWyULFDVVLQRÀFFLRQHVSRGHURVDVTXHSURGXFHQVXVSURSLDVVRPEUDVTXHHQFULSWDQVX historia y su contingencia. (QODÀFFLyQFRORQLDOGHOJpQHURTXHMHUDUTXL]DORFODUR\ORRVFXURODVHGXFFLyQVLHPSUH quedará del lado de lo oscuro y portará consigo el estigma de lo femenino. Si nos detenemos en la seducción es porque en el travesti, también ensombrecido por la colonialidad del género, algo de esa SRWHQFLDHVWiHQMXHJR/DVHGXFFLyQWLHQHTXHYHUFRQODIRUPDHQTXHHOSRGHUVHSUHVHQWDFRPRLQ 36 17 Pablo Oyarzún, “Para un análisis ÀJXUDOGHOSRGHUµHQ:LOO\7KD\HU\ Pablo Oyarzun, eds. Dossier Mímesis y Política, en Archivos, n. 2/3 (2009): 33-52. 18 Jacques Derrida, “Leer lo ilegible. Entrevista con Carmen González-Marín,” Revista de Occidente, n. 62-63 (1986): 160-182. 19 Véase Giuseppe Campuzano, "Genealogía velada del futuro travesti," en Miguel López, ed. Giuseppe Campuzano. Saturday Night Thriller y otros escritos, 1998-2013 (Lima, Estruendomudo, 2013), pp. 200209. Las cursivas son mías. [Nota del editor: Como un legado de los moros y musulmanes que huyeron de la persecución en España, las ‘tapadas limeñas’ fueron comunes en la élite española poco después de llegar al Perú en el proceso de colonización española de las Americas TXHVHLQLFLDHQ$ÀQHVGHO siglo XVI en América del Sur, el ConVHMRGH,QGLDVYLRHQODVWDSDGDVXQ peligro potencial para el imperio colonial dado que la identidad sexual GHORVFXHUSRVEDMRHOYHORQRSRGtD ser controlada. Aquella referencia ha VLGRDVXPLGRFRPRÀJXUDSUHFXUVRUD de movimientos de resistencia feministas, queer y transgénero. Véase &RFR)XVFR´:HZHDUWKHPDVNµ en Ella Shohat (ed.), 7DONLQJ9LVLRQV Multicultural Feminism in a Trans- national Age, Massachusets, MIT Press, 2001, pp. 113-118]. 20 Tomo el término prestado del texto inédito del historiador y poeta José Carlos Agüero, Los rendidos. Sobre el don de perdonar. Texto presentado en las sesiones del “Grupo Memoria,” Instituto de Estudios Peruanos (IEP), Lima, 24 de octubre de 2013. 21 Pablo Oyarzún, “Identidad, diferencia, mezcla: ¿pensar Latinoamérica?,” en La desazón de lo moderno. Problemas de la Modernidad (Santiago de Chile, Universidad Arcis/ Cuarto Propio, 2001), p. 393. sinuación.17 Para que haya seducción es preciso que ocurra un ocultamiento y una promesa: hay seducción cuando “hay deseo y placer prometido pero no dado, cuando hay algo que todavía no se ha desnudado”.186HWUDWDHQWRQFHVGHXQSRGHUSHURGHXQSRGHUTXHVHHMHUFHEDMROH\HVGHMXHJRELHQ claras: se lo marca como el poder del débil y a la vez como peligro, como un enemigo que hay que GRPHVWLFDU/DDQLPDOLGDGODSURPLVFXLGDGODLPSXUH]DODFRQWDPLQDFLyQODSHUYHUVLGDGODKHUHMtD todos atributos femeninos, son estigma y huella de lo que, desde la perspectiva colonial, aparece como lo fuera de controlGHODVXEDOWHUQLGDG GHODPXMHUGHO[VLQGL[VGHO[VQHJU[V  (VSRVLEOHTXHHQODVHGXFFLyQHOVXEDOWHUQRSXHGDSRQHUHQMXHJRXQDDJHQFLDDXQTXH VHDXQDDJHQFLDPXGDHQODVVRPEUDV$VtFXDQGRHOÀOyVRIRWUDYHVWL*LXVHSSH&DPSX]DQRHYRFD ´HOGHVHRVLPXODGRUµGHOYHORGHOD¶WDSDGDOLPHxD· PXMHUHVFRQVXVURVWURVFXELHUWRVGHVGHHO VLJOR;9, SRQHHQHYLGHQFLDODDJHQFLDDPHQD]DQWHGHDTXHOORVFXHUSRVTXHWUDÀFDQXQDLQIRUPDFLyQ ambigua e incierta, equiparando incluso: “la propagandaEDMRHOPDQWROLPHxR « DO>PLHGRRFFL dental contemporáneo del] explosivoEDMRHOYHORiUDEHFRPRWUDYHVWLVPRVVXEDOWHUQRVGHODSDODEUD negada”.19 Sin embargo, no siempre la agencia ocurre en dirección a la emancipación. Puede ocurrir otra cosa: que la restricción de alternativas y las constricciones del campo de acción propias del subDOWHUQRSXHGDQKDFHUORHMHUFHU´XQDDJHQFLDPLVHUDEOHµ20, una agencia que lo desgarra. 7DOYH]FRPRVHxDODODÀOyVRIDLQGLD*D\DWUL6SLYDNHOVXEDOWHUQRQRSXHGHKDEODU3HUR HVSRVLEOHTXHHVHVLOHQFLRSRUWHFRQVLJRXQSRGHU2FRPRVXJLHUHHOÀOyVRIR3DEOR2\DU]~QXQDUHWLcencia: “el silencio del ladino [del colonizado] es como su arte de seducción por respuesta a la Conquista y como reserva interminable a verse resuelto en lo pintoresco, lo exótico, lo patético”. Esa reserva puede ser una forma de guardar para el futuro, de acumular, de capitalizar. Pero también “se puede reservar meramente la reserva, esto es, abrir dentro de sí un hueco donde algo podría advenir”.21 ¿No hay algo de esta lógica de la reserva, del resguardo, del silencio, en el retiro hacia una casa abandonada por parte del Grupo Chaclacayo? Un retiro que comienza en 1982, año preciso en que el gobierno peruano entrega a las fuerzas armadas el control de las zonas de la sierra sur del país como estrategia para enfrentar la guerra declarada dos años antes por Sendero Luminoso.22 ¿No hay en ese retiro un intento latente de crear una especie de pequeño contra-Estado, otra forma de ‘zona liberada’, en donde acontezca algo que quizá de otro modo no habría podido ocurrir? Retirarse para sustraerse de la escena de la negociación del mercado, de las instituciones, del mandato familiar, con la intención de crear contra-prácticas subversivas, otras relaciones sexo-afectivas que desarmen el amor dual, SDVDUGHOGRVDOWUHV²TXHFRQVXVFRPSOHMLGDGHVDFLHUWRV\IUDFDVRVGHVSOHJyRWUDVIRUPDVSRVLEOHV de vinculación erótica. Sustraerse enteramente con excepción de un momento en que el aislamiento se rompe: la exposición realizada en el Museo de Arte de Lima en 1984, el momento de la caída del velo: cuando ante la censura de sus obras “el público levantó el velo”.23 37 22 [Nota del editor: El 30 de diciembre de 1982 el Gobierno Peruano delega poderes amplios de lucha contra-subversiva a las Fuerzas $UPDGDVFRQHOREMHWLYRGHUHFXSHUDU el control de varias zonas del interior del país. Las autoridades políticas QRDFWLYDURQHQWRQFHVVXÀFLHQWHV mecanismos de protección a los derechos humanos y el abuso fue, en parte, estrategia inherente de la lucha militar. Sobre ello ver Comisión de la Verdad y Reconciliación, Informe Final (Lima: CVR, 2003).] 23 La única exposición del grupo Chaclacayo en Lima ocurre en el Museo de Arte de Lima en 1984. Varias obras de Zevallos y Avellaneda son inicialmente censuradas por DXWRULGDGHVGHODHPEDMDGDDOHPDQD que cubren las obras con telas negras. Como respuesta, durante la inauguración “el público levantó el velo de una manera natural.” Miguel Silvestre, “A propósito de una muestra de ‘Chaclacayo’: Cuando el ser auténtico resulta ser peligroso,” (O'LDULRGH0DUND Lima, 27 de noviembre de 1984, p. 18. Reproducido en este volumen en la página 115. Nelly Richard. Mientras Juan DominJR'iYLOD\1HOO\5LFKDUGHVFHQLÀFDQ en vivo una versión invertida de La Pietá, en la que Dávila ocupa el lugar de la madre y Richard el lugar GHOKLMRVHPXHVWUDXQYLGHRHQHO que Dávila presenta una segunda HVFHQLÀFDFLyQGHLa Pietá, esta vez con otro hombre, como relación homosexual. Luego, Carlos Leppe LQJUHVDDOUHFLQWRYHVWLGRGHWUDMH y lee un texto sobre su posición en el campo artístico chileno. 24 Jean Baudrillard: De la seducción (Madrid: Ediciones Cátedra, 1986). 26 Patricio Marchant, “Sobre el uso de ciertas palabras,” en Pablo 2\DU]~Q\:LOO\7KD\HUHGV Escritura y Temblor (Santiago de Chile, Editorial Cuarto Propio, 2001), p.76. 25 En la performance participaron Carlos Leppe, Juan Domingo Dávila y III. Todo lo que sin máscara, sin maquillaje y sin rostro, está entregado a la operación pura del sexo o de ODPXHUWHWRGRHVRSXHGHVHUGHQRPLQDGRREVFHQR\SRUQRJUiÀFR Jean Baudrillard24 7RGDODGLVWULEXFLyQMHUDUTXL]DGDGHODVHQHUJtDV\ORVUROHVHQWUHORPDVFXOLQR\ORIHPHQLQRSXHGHVHU GHVRUJDQL]DGDVDFXGLGDUHIRUPXODGDHQHOMXHJRWUDYHVWL(Q6DQWLDJRGH&KLOHFRPRSDUWHGHOD performance La Biblia realizada en el Instituto Chileno Francés en 1982,25 Juan Domingo Dávila presenta dos imágenes: La Biblia de María Dávila y /LEHUDFLyQGHOGHVHRɀ/LEHUDFLyQVRFLDO>ÀJ@ En La Biblia de María Dávila una fotografía muestra al artista travestido de virgen, usando FRPRYHORXQDEDQGHUDGH&KLOH(OSHUVRQDMHOOHYDORVODELRVSLQWDGRVHOURVWURPDTXLOODGRGHEODQFR el brazo izquierdo erecto y empuñado, y sobre la imagen se lee la leyenda “Reina de Chile / Pan nuestro”. ‘Reina de Chile’ es un apodo de la Virgen del Carmen, virgen de origen colonial que durante la ReS~EOLFDHVGHFODUDGDSDWURQDGHOHMpUFLWR\HQORVDxRVGHODGLFWDGXUDUHLYLQGLFDGDFRPRtFRQRSRUOD FXOWXUDPLOLWDURÀFLDO6XÀJXUDQRVyORFRQWULEX\HDODLPSRVLFLyQGHODPDWUL]FRORQLDOGHOJpQHURHQHO continente, sino que también funciona en el imaginario español como emblema en los procesos de genocidio indígena. En la imagen de Dávila, la Virgen del Carmen es travestida y trastocada con la cita al saludo con el puño cerrado, gesto que en las culturas de izquierda condensa la fuerza de la amenaza insurgente. La imagen no sólo sugiere una zona promiscua entre el discurso nacional católico y el de la izquierda partidaria (su violencia heteronormativa, su homofobia). También advierte que durante la dictadura chilena, la izquierda entra en complicidad con una parte de la Iglesia Católica que levanta su voz para defender a los ciudadanos de la represión militar. En este sentido, la imagen de Dávila parece MXJDULUyQLFDPHQWHFRQODLGHDGHODLPSRWHQFLDGHOGLVFXUVRGHL]TXLHUGD WUDVHOGHUURFDPLHQWRGHOD Unidad Popular), parodiando su noción de emancipación como una cuestión de fe. Pero la fuerza amenazante de la imagen no está sólo en el puño, sino también en la H[DOWDFLyQGHORVODELRVSLQWDGRVTXHFDQMHDODÀJXUDGHYLUJHQPDGUHSRUODGHYLUJHQSURVWLWXWD /DUHSUHVHQWDFLyQGHODYLUJHQFRPRPDGUHVH[XDOSRQGUtDHQPDUFKDFRPRVXJLHUHHOÀOyVRIR3DWULFLR 0DUFKDQWXQWUDEDMRGHOLEHUDFLyQDOSUHVHQWDU´ODPDGUHODWLQRDPHULFDQD«DÀUPDGDFRPRPDGUH sin ley del padre”.26 (QODVHJXQGDLPDJHQDFRPSDxDGDGHODFRQVLJQD´/LEHUDFLyQGHOGHVHRɀ/LEHUDFLyQ VRFLDOµ'iYLODH[KLEHVXURVWURGHVFXELHUWR\VLQPDTXLOODMH(OYHOREDQGHUD\ODSHOXFDVREUHVX cabeza utilizadas en la imagen anterior caen ahora sobre sus hombros y torso desvestido. El brazo derecho ahora doblado se levanta sobre su cabeza citando la retórica gestual de una languidez erótico-femenina al tiempo que la endurece con la tensión amenazante de la mano empuñada: Dávila tuerce el saludo con el puño cerrado de la militancia de izquierdas invocando el imaginario del ÀVWIXFNLQJ(abandono del pene y empleo sexual de dos órganos reprimidos, condenados y abyectos: el ano y la mano-brazo). 38 27 Agradezco a Sergio Zevallos el haberme hecho notar esta operación de ‘segundo travestismo’ en la obra de Dávila, en el conversatorio realizado a propósito de la exposición Un cuerpo ambulante en el Museo de Arte de Lima, el viernes 15 de diciembre de 2013. 6ODYRM=L]HNA propósito de Lenin. Política y subjetividad en el capitalismo tardío (Buenos Aires: Atuel/ Parusía, 2004). (OHMHPSORPiVYLROHQWRGHHOOR quizás no sea tanto el fallido intento de censura de la muestra del grupo en 1984, sino la acusación lanzada contra el Grupo Chaclacayo de hacer (VWDLPDJHQSXHGHVHUOHtGDFRPRXQGHYHODPLHQWRGHODUWLÀFLRTXHGLVROYHUtDHOVLPXOD cro travesti para restituir una corporalidad masculina pre-existente, supuestamente intacta. Sin embargo, la caída del velo-bandera y la máscara cosmética dan cuenta de aquél saber travesti que advierte que el develamiento siempre será un movimiento del velo, que la revelación es siempre un momento de volver a encubrir. Así, Dávila desmaquillado traviste la imagen de María-Dávila al torcer la fuerza eréctil, fálica del puño.27 )LVWIXFNLQJ: una penetración sin fecundación (ni del cuerpo, ni GHODFRQVFLHQFLDQLGHODQDFLyQ JDVWRSXURGHXQFXHUSRPDVFXOLQRTXHVHDÀUPDSHQHWUDEOHFRPR cualquier otro cuerpo. 3RUVXSDUWH6HUJLR=HYDOORVWUDYLVWHODÀJXUDGH6DQWD5RVDGH/LPDXQSHUVRQDMHTXH porta consigo toda una pedagogía de la represión sexual puesta a prueba sobre ella misma. La iglesia y la ideología dominante cuentan la historia de una Santa Rosa que aunque de origen mestizo apareFHGRWDGDGHXQDSXUH]DHQWHUDPHQWHEODQFDDVXPLHQGRHOODXQDXWRÁDJHODPLHQWRTXHHOHYDVXV p[WDVLVPtVWLFRV HUyWLFRV FRPRPRGHORHMHPSODUGHFRPSRUWDPLHQWR6DQWD5RVDDSDUHFHDVtHQODV REUDVGH=HYDOORVFRPRXQVHUKtEULGRYtFWLPD\YHUGXJRÀHOWHVWLJRGHODLQWUR\HFFLyQGHODVGLVFLSOLQDV que buscan depurar al cuerpo de sus excesos para volverlo casto y productivamente útil. Sin embargo, el discurso dominante no se hace cargo del placer masoquista que contiene el autocastigo. Omite que en las ambivalencias del masoquismo habita también una contra-pedagogía: “la tortura del masoquista frustra al sádico porque le priva de su poder. El sadismo implica una relación de dominio, mientras que el masoquismo es el primer paso necesario hacia la liberación”.28 /DUHFRGLÀFDFLyQWUDYHVWLGH6DQWD5RVDWDOFRPRDSDUHFHHPEOHPiWLFDPHQWHHQODVHULH Rosa Cordis  >ÀJ@WLHQGHDVHUOHtGDFRPRXOWUDMHSXHVVHEXUODGHODLFRQRJUDItDUHOLJLRVD RÀFLDO\DODYH]H[SRQHXQDFRPSOLFLGDGQRGLFKDHQWUHODUHWyULFDGHOGLVFXUVRQDFLRQDOFDWyOLFRFRORnial y el terrorismo de Estado. Se trata de una operación que porta la fuerza de la provocación y que DWUDHODSURKLELFLyQFRPRUHVSXHVWD(VODOyJLFDGHODKHUHMtDDKtGRQGHODFHQVXUD\ODHVWLJPDWL]Dción se sienten como en casa.29 Pero lo que el discurso conservador no suele ver es que lo intolerable de estas imágenes es lo que dicen entre líneas: hay en el propio Estado un goce sádico de transgresión GHODOH\FXDQGRpOPLVPRHMHFXWDDFWRVLOtFLWRVTXHWUDHQFRQVLJRODUHGXFFLyQGHOFXHUSRGHORWURD VXSXUDDQLPDOLGDG/DWRUWXUDSXHGHVHUSHQVDGDDVtFRPRXQPHFDQLVPRSHUYHUVRGHVXEMHWLYDFLyQ DWUDYpVGHOFXDOORVLQGLYLGXRVVHLGHQWLÀFDQFRQHO(VWDGR1DFLyQ\HQGRQGHHVODSURSLDYLROHQFLD lo que a su vez los constituye como ciudadanos.30 En otras series de Zevallos como Detritus (1986), una Santa Rosa travestida es presentaGDGHVGHVXSRVLFLyQGHYtFWLPD$OLQWHULRUGHXQDXUQDSUHFDULDODÀJXUDH[WHQGLGDGH6DQWD5RVDHV FXELHUWDSRUXQDPRUWDMDPRVWUiQGRVHFRPRXQD¶UHOLTXLD\DFHQWH·FXHUSRLQFRUUXSWRYHODGRHURWL]DGR>ÀJ@5DVJDUODPRUWDMDFRUUHUHOYHORHVDKtFRPRGHVJDUUDUHOKtPHQ\HOYHORDSDUHFHHQWRQFHV FRPRVLJQRGHODDOLDQ]DHQWUHIHWLFKLVPR\QHFURÀOLDTXHUDVWUHDVXVKXHOODVHQHOGLVFXUVRFRORQLDO Si la fantasía patriarcal redoblada por el discurso de blanqueamiento racial y moral construye un mito de Santa Rosa como encarnación de la pureza, las imágenes de Detritus PXHVWUDQORDUWLÀFLDOGHOPLWRDO 39 con su obra una apología a Sendero Luminoso por parte del crítico Luis Lama en 1989. En ese momento una imputación de ese tipo podía tener graves consecuencias para la vida de los integrantes del grupo. Véase Luis E. Lama, “Perversión y complaciencia,” Caretas, Lima, 20 de noviembre de 1989, pp. 74 -76. temporáneo (Lima, Instituto de Estudios Peruanos, 2002), p. 55. 30 Así lo sugiere el crítico cultural Víctor Vich cuando señala: “los Estados nacionales toman contacto con los ciudadanos a través de la tortura forzándolos a un proyecto disciplinario que consiste en una REVFHQDLGHQWLÀFDFLyQFRQHOGRORUµ Victor Vich, El caníbal es el Otro: 9LROHQFLD\FXOWXUDHQHO3HU~FRQ- 34 Ana Penchaszadeh, “Democratizar el problema de la hospitalidad. Deconstruir el concepto de hospitalidad incondicional,” conferencia presentada en las Primeras Jornadas Debates Actuales de la Teoría Política Contemporánea, Buenos Aires, 2010. 31 Zevallos, “Der Obszöne Tod,” p. 4 32 Silveste, “A propósito de una muestra de ‘Chaclacayo’,” p. 18. 33 Ibid. 35 Victor Vich recoge un relato que narra la toma del fundo experimental GH$OOSDFKDNDDPDQRVGHXQJUXSR de senderistas. Creado por la Universidad Nacional San Cristobal de Humanga en Ayacucho, el fundo estaba dedicado a la capacitación de campesinos SDUDHOWUDEDMRDJUtFROD\JDQDGHUR Al iniciar la toma, los senderistas entraron a los establos y comenzaron a disparar indiscriminadamente a los animales. Mientras el ganado caía al suelo, las campesinas empezaron a llorar. Para Vich, el llanto como interrupción, cumpliría en esta escena la IXQFLyQGH´DUWLFXODURWURVLJQLÀFDGR frente a los animales restituyendo el vínculo con lo humano.” Vich, El caníbal es el Otro, p. 41. exhibir la promiscua caída de la santa en los desperdicios. El mandato de pureza que busca suprimir lo ‘mugriento’ no lo consigue eliminar, apenas lo desplaza hacia un deseo por el cadáver. O como señala Zevallos: tras la muerte de Santa Rosa “un pueblo ávido de poseerla en reliquia profanó su cuerpo indefenso apenas fallecido”.31 Una de las imágenes de esta serie muestra la precaria urna mortuoria de Santa Rosa, y SRUGHEDMRGHHOODVHYHXQFXHUSRVHPL GHV HQWHUUDGR>ÀJ@/DYLVLELOLGDGREVFHQDGHHVHFDGiYHUGHVXFRVLÀFDFLyQUHWRUQDFRPRXQHFRGHODVPXFKDVLPiJHQHVGHIRVDVFRPXQHVGHORVFXHUSRVLQVHSXOWRV\ODVWXPEDVFODQGHVWLQDVKDOODGDVGXUDQWHHOFRQÁLFWRDUPDGRHQHO3HU~3HURDTXHO cuerpo yacente nos transporta también al cementerio indígena, pues ¿qué otra cosa podría estar GHEDMRGHODWXPEDGHODVDQWDFRORQLDO" En una entrevista de 1984, Zevallos coloca como contracara de la santa limeña al FXHUSRFDPSHVLQRLQGtJHQDYLROHQWDGR´0LHQWUDV6DQWD5RVDVHÁDJHOD\VHSURGXFHGRORUItVLFRSDUD VHUPLVWLÀFDGDHQHVWHSDtVVHWRUWXUDQ\VHGHVKDFHQFXHUSRV\SDUDHOORVQRKD\SHUGyQµ32 Pero DGLIHUHQFLDGHODÀJXUDWUDYHVWLGDGH6DQWD5RVDFX\RURVWURDSDUHFHVLHPSUHXOWUDPDTXLOODGR —entre la iconografía de la prostituta y la virgen, lo que sugiere que para Zevallos la historia del Perú es algo que ocurre entre la hagiografía y el burdel—, el cuerpo subalterno aparece en las obras Detritus (1986) y Rosa Cordis (1986) como un cuerpo sin rostro. Es decir, un cuerpo que evoca una “animalidad anterior a lo humano”33 HODQLPDOQRWLHQHURVWURGHFtDHOÀOyVRIR(PPDQXHO/pYLQDV  La cuestión es dónde está la línea divisoria entre el humano y sus otros. Siempre es posible decir: “¡No somos animales, exigimos respeto!”34 Sin embargo, una relectura de la animalización colonial del indígena y el negro permite advertir que la distinción entre lo humano y lo animal es enteramente SROtWLFD\YDDGTXLULHQGRP~OWLSOHVÀVRQRPtDVSDUDMXVWLÀFDUHOVDFULÀFLRGHORWUR<DVHDDWUDYpV del terror que provocan los perros ahorcados en los postes de Lima por Sendero Luminoso en los LQLFLRVGHODJXHUUDVXEYHUVLYDRGHVGHHOOXJDURSXHVWRHOOODQWRGHODVPXMHUHVFDPSHVLQDVTXH GHWLHQHODPDWDQ]DGHJDQDGRSRUSDUWHGHVHQGHULVWDVHQ$OOSDFKDND35, lo que se vislumbra es una zona de indistinción entre el animal y el humano que, en el contexto de la guerra, viene a perturbar ODÀMH]DGHHVDIURQWHUD $KRUDELHQ¢TXpGLFHHVWDUHLWHUDFLyQVREUHODSHUWXUEDFLyQPDULFDGHÀJXUDVUHOLJLRVDV IHPHQLQDV\PDWHUQDVFRPRWUDLFLyQDOGLVFXUVRRÀFLDO\FRQWUDUHSUHVHQWDFLyQGHODHVWUXFWXUDKHWHURQRUPDWLYD\FRORQLDOGHSURGXFFLyQGHVXEMHWLYLGDGHQFRQWH[WRVGHYLROHQFLDSROtWLFDHQ3HU~\HQ&KLOH" Es posible pensar que en su crítica a las ideologías que asignan las naturalezas masculinas y femeninas, las operaciones que realizan estos artistas son matriarcales y matricidas a la vez. 6XVSUiFWLFDVLQWHUYLHQHQVREUHODÀJXUDRFFLGHQWDOGHODPXMHUFRPRPDGUHTXHHQWDQWRSULPHUFXHUSR deseado, sería a la vez el primer cuerpo vedado. Pero también contienen una intervención sobre las representaciones de la maternidad como posición que modela las nuevas generaciones a través del control de conductas y hábitos, de la transmisión de una lengua, una moral, una ideología. Decir madre HVKDEODUGHXQDÀJXUDPRQWDGDVREUHWRGDXQDWUDPDGHVDEHUSRGHUTXHHQ$PpULFD/DWLQDHQFXHQ- 40 36 Marchant, “Sobre el uso de ciertas palabras,” p.79. (Buenos Aires: Amarrortu, 2008), p.105. 37 En su análisis sobre el masoquismo, Deleuze ha advertido esta operación cuando se detiene en ODÀJXUDGHOFRQWUDWRPDVRTXLVWD “El contrato pone en manos de la madre la aplicación de la ley paterna. Pero esta transferencia es singuODUPHQWHHÀFD]FRQHOODFDPELD toda la ley y ahora, ordena lo que estaba encargada de vedar. La culpa vuelve inocente aquello que estaba encargada de hacer expiar, la punición vuelve permitido lo que estaba encargada de sancionar.” Gilles Deleuze, Presentación de Sacher-Masoch. Lo frío y lo cruel 38 Un gesto que tal vez hace irrumpir huellas de un pasado pre-colonial. Recordando la teogonía andrógina, previa a la invasión colonial, Giuseppe Campuzano señala: “El análisis de los mitos andinos de origen amplía esta unidad al binomio PDGUHKLMRPLHQWUDVODSDUHMDFRQ \XJDOWDQWRFRPRODÀJXUDGHOSDGUH VHKD\DQDXVHQWHVDVtODVGRVSURhibiciones fundamentales, el incesto y el parricidio—y la consiguiente tradición paterna, son desconocidas. Tales proposiciones constituyen una alternativa a la simbología de Lacan donde el patriarcado parece ser inevitable.” Giuseppe Campuzano, “Andrógino,” en Museo Travesti del Perú, p. 84. 39 Como señala Butler: “En la medida en que hay formas de amor que están prohibidas o al menos, privadas de realidad por parte de las normas que establecen el tabú del incesto, tanto la homosexualidad FRPRHOLQFHVWRSXHGHQFDOLÀFDUVH como dichas formas. En el primer caso, la desrealización conduce a una falta de reconocimiento como amor legítimo: en el segundo, conduce a una falta de reconocimiento hacia lo que puede hayan sido una serie de encuentros traumáticos, aunque es importante tener en cuen- tra su ideal en las representaciones católico-coloniales de vírgenes y santas: una forma casta, disciSOLQDGDREHGLHQWHDXVWHUDGHODPXMHU Frente a ello, las imágenes de Zevallos y de Dávila impregnan de un erotismo exacerbado \YLROHQWRODÀJXUDGHODYLUJHQPDGUH(OPRGRHQTXHHVWDVLPiJHQHVDFDULFLDQPDOLQWHQFLRQDGDPHQWH a la madre supone “una transgresión violenta del discurso —por ende de la realidad— latinoamericana, discurso que culmina no como el discurso europeo en un dios padre sino directamente en una diosa madre”.36 Las obras advierten que el ideal católico colonial de la virgen-madre sugiere también su contrario: su contracara oscura, reprimida, subterránea, de una madre sexual. Y traspasar la autoridad simbólica del padre hacia una madre sexual no ocurre sin consecuencias.37 Su efecto es desorganizador: las representaciones de La Pietá que realiza el Grupo Chaclacayo (La agonía de un mito maligno,  >ÀJ@\-XDQ'RPLQJR'iYLOD La Biblia, 1982 HQIDWL]DQHOELQRPLRPDGUHKLMRSUHVHQWiQGROR como un vínculo (homo)sexual, donde el padre ya no tiene lugar.38 Estas imágenes perturban así la SURKLELFLyQGHOLQFHVWRFRPRHMHRUJDQL]DGRUGHODLGHQWLGDG\GHODVIRUPDVGHDOLDQ]D\SDUHQWHVFR heteropatriarcales,39DEULHQGRHOFDPSRGHLQWHOLJLELOLGDGDPRGRVQRQRUPDWLYRVGHÀOLDFLyQ\GH vínculo sexo-afectivos. IV. Hablamos al inicio del modo en que se gestiona la representación del cadáver como forma de administración del terror, pero también es posible pensar su contraparte: los procesos de exhumación que VLOHQFLRVDPHQWHSHUVLJXHQODE~VTXHGDGHHVRVFXHUSRVUHOHJDGRVDODLPSRVLELOLGDGGHODMXVWLFLD\ GHOULWRGHGXHOR$SDUHFHHQWRQFHVRWUDÀJXUDHQWUHHVWDVH[SHULHQFLDVGHGLVLGHQFLDVH[XDOHOFXHUSR enterrado en cal como signo de aquella imposibilidad y como denuncia de la reducción de los cuerpos. La cal, en tanto dispositivo de higiene social y tecnología de reducción de cadáveres que aniquila toda huella del crimen, es cifra directa del horror.40 En Homenaje a Sebastián Acevedo (1991), las Yeguas del Apocalipsis toman la cal viva FRPRPDWHULDOSULQFLSDOGHVXDFFLyQ>ÀJ@41 Mientras se escucha el recitado de los números de documentos de identidad y los nombres de distintas ciudades de Chile, ambos artistas permanecen desvestidos y acostados, inmóviles, cubiertos de cal viva (que en contacto con la humedad de la piel produce leves quemaduras). Sus cuerpos aparecen así como entidades sin nombre, devenidos cifra, número, en la escena de la fosa común. La cal viva señala el ritual de aniquilamiento de eso llamado el ‘cáncer marxista’–como el dictador Pinochet llamaba a los movimientos de izquierda– y de todos los opositores al régimen dictatorial. Pero también la cal subraya la limpieza social de los cuerpos portadores de la llamada ‘peste rosa’ (el VIH/SIDA). Las Yeguas del Apocalipsis intervienen así sobre las representaciones de las víctimas de la dictadura interponiendo la imagen del cuerpo homosexual erotizado y a la vez estigmatizado por su sexualidad. 3RUVXSDUWHHQODVHULHIRWRJUiÀFDEntierro de cal (ca. 1986-1987), aparece un personaMHDQyQLPRYHVWLGRFRPRVLIXHUDXQD¶WDSDGDEODQFD·HOFXDOHMHFXWDHODFWRGHURFLDUHQFXEULU\HQWH- 41 ta que no todas las formas de incesto son necesariamente traumáticas SRUHMHPSORHQODOLWHUDWXUDGHOVLJOR XVIII a veces se presenta el incesto entre hermana y hermano como idílico).” Judith Butler, Deshacer el género (Paidós: Barcelona, 2006), p.227. 41 La acción fue concebida como XQKRPHQDMHD6HEDVWLiQ$FHYHGR el hombre que prendió fuego a su propio cuerpo como protesta frente DODGHVDSDULFLyQGHVXVKLMRV/D inmolación ocurrió en la Plaza de Armas de Concepción en Chile, en noviembre de 1983. 40 Es preciso recordar que fue en una mina de cal en la localidad de Lonquén, en 1978, donde fueron hallados los primeros cuerpos de personas desaparecidas durante la dictadura de Pinochet. La noticia se hizo inmediatamente pública, constituyendo la primera prueba de que los desaparecidos podían estar muertos. 42 Comunicación personal con Zevallos, 19 de septiembre de 2013. 45 Entrevista a Sergio Zevallos. Lima, 25 de noviembre 2013. 43 Sarduy, Ensayos generales sobre el barroco, p. 87 44 Al inicio de la acción el cuerpo se cubre solo parcialmente, para terminar enteramente cubierto de cal. UUDUDRWURFXHUSRFRQFDO>ÀJ@(OFXHUSRDFRVWDGRHVXQFXHUSRGHVQXGRFRQODVSLHUQDVDELHUWDV “un cuerpo entregado, también en sentido sexual”.42 En la acción la ‘tapada blanca’ condensa lo femeQLQRSHURDGLIHUHQFLDGHRWUDVREUDVGH=HYDOORVHQHVWDVHULHHOREMHWRGHGHVHRVHHQFXHQWUDHQHO FXHUSRQRWRULDPHQWHPDVFXOLQRTXH\DFHERFDDEDMR\TXHSRUHOORPLVPRWHUPLQDGLVROYLHQGRVXV marcas de género. El travesti cede paso al andrógino. Se trata de un cuerpo que es cubierto con cal y luego descubierto, una y otra vez. En su fría teatralidad la imagen es casi el reverso del ‘entierro lasciYRGH6DQWD5RVD·HVFHQLÀFDGRHQDetritus. (OFXHUSRPDULFDVHFXEUHFRQFDOFRPRtQGLFHGHOKRUURUSHURSDUDHMHUFHUVREUHHVH procedimiento una transmutación adicional: usar la cal como pigmento, como ornamento erotizante, FRPRPDTXLOODMH&RPRVHxDODHOHVFULWRU6HYHUR6DUGX\KD\XQUHJLVWURFRP~QHQWUHHOPDTXLOODMHHO WDWXDMH\ODWRUWXUDWRGRV´SHUWHQHFHQDHVHPLVPRUHJLVWURGHOGHVPHPEUDPLHQWRGHODIUDJPHQWDFLyQ&RQHOGRORUFRQODWLQWDVHGHOLPLWDXQDSDUWHGHOFXHUSR\DIXHU]DGHWUDEDMRVHODVHSDUDGHOD imagen del cuerpo como totalidad”.43 En la acción de las Yeguas del Apocalipsis y en la de Zevallos, la cal como pigmento evoca la lógica de la fragmentación fetichista y a la vez la suspende, pues tiende a cubrir todo el cuerpo.44 No es una parte, sino la totalidad del cuerpo la que está subrayada, fríamente sexualizada. Y de este modo las huellas del género se tornan ambiguas, indecidibles, perturbando los UROHVVH[XDOHVÀMRV$OJRRFXUUHDKt´ODSRVLELOLGDGGHUHFXSHUDUSRUTXHGHHVRVHWUDWDUtDDOÀQDOXQD seducción que comience a expandirse de una forma amorfa e imprecisa, no solamente entre los géneros sino también entre las edades…”.45 Erotizar la abyección implica quizás una operación que transmuta la crueldad en éxtasis, en un éxtasis frío. Fernanda Carvajal (Santiago de Chile, 1982) Socióloga, investigadora y docente. Actualmente es becaria CONICET y realiza el doctorado en Ciencias Sociales en la Universidad de Buenos Aires. Ha HMHUFLGRODGRFHQFLDHQOD8QLYHUVLGDG&DWyOLFDGH&KLOH\HQOD8QLYHUVLGDGGH Buenos Aires. Es coautora del libro Nomadismos y ensamblajes. Compañías teatrales en Chile, 1990-2008 (Santiago de Chile: Editorial Cuarto Propio, 2009). Además, ha publicado artículos sobre teatro, arte y disidencia sexual en libros y revistas de distintos países. Desde el año 2009, es miembro de la Red Conceptualismos del Sur y como tal, formó parte del equipo curatorial de la muestra Perder la forma humana. Una imagen sísmica de los años 80 en América Latina en el Museo Nacional Centro de Arte Reina Sofía, Madrid, 2012-2013. 42 7KLVTXRWDWLRQLVWDNHQIURP the artist’s notes on the series Suburbios (1983). Zevallos calls these notes the ‘scripts’ of the series. 2 This is how they were described in the article: “Ostentación de sus desviaciones sexuales hicieron los maracos en la Plaza de Armas,” El Clarín, Santiago de Chile, 24 April, 1973. [Editor’s note: The term ‘mare’ LVDÀJXUHRIVH[XDOVXEPLVVLRQ,Q Chile, the use of this word to mean voluptuous woman, prostitute, but also homosexual, is considered SHMRUDWLYH@ 3 See “El tercer sexo en el primer poder,” Oiga, Lima, 11 December, 1978. [Editor’s note: The transves- Cold Ecstasy Fernanda Carvajal And the belly of the queers— veiled in true roses. Sergio Zevallos1 ,Q&KLOHDQG3HUXWKHÀUVWULRWVRIVH[XDOGLVVLGHQFHWR EUHDNLQWRWKHSXEOLFUHDOPZHUHOHDGE\WUDQVYHVWLWHSURV titutes: by criminalized sexualities for whom the revolution is one of survival. In Chile the congregation of “yeguas sueltas y locas perdidas” [loose mares and sissies]2 in WKH3OD]DGH$UPDVLQ6DQWLDJRRFFXUUHGMXVWDIHZPRQWKV EHIRUHWKHPLOLWDU\FRXSLQ6HSWHPEHU>ÀJ@,Q /LPDDJURXSRIWUDQVYHVWLWHVOHIWWKHLUPDUNRQTXHHUSURtest as much in the street as in the brothel: in the daytime they marched towards Congress to demand the abolishing RIGLVFULPLQDWLRQ MXVWDVWKH3HUXYLDQ&RQVWLWXHQW$VVHPbly was being formed in 1978) and in the evening they put on the show “Transvestites in Prostitution” in a local WKHDWUH>ÀJ@37KHVHZHUHVRPHRIWKHÀUVWFROOHFWLYH actions in Peru and Chile to confront the colonial and hetero-capitalist mechanisms of oppression of desire and the body. 7KHWUDQVYHVWLWHLVDWDFWLFDOÀJXUHWKDWVHUYHGWR SURYRNHDGLDORJXHEHWZHHQWKHGLYHUVHH[SHULHQFHVRI sexual dissidents emerging in the Peruvian and Chilean FXOWXUDOVFHQHVLQWKHV7RVD\WUDQVYHVWLWHLVÀUVWRI DOOWRGHVLJQDWHDELRJUDSKLFDODQGVRFLDOUHDOLW\DVXEMHFW PDUNHGE\WKHVXERUGLQDWLRQRIFODVVDQGDGLVREHGLHQW body exposed to transphobic violence and economic precarity. The artist and Chilean activist Felipe Rivas warned recently that the term ‘transvestite’ should always be articulated in the plural in order to decentralize the WHQGHQF\WRFROOHFWPXOWLSOHGHÀQLWLRQVDQGOLYHGH[SHULHQFHV XQGHUDVLQJOHFDWHJRU\RILGHQWLÀFDWLRQ4 So we will say transvestisms: transvestisms from the South that produce baroque luxury from dispossession. tites appealed to the Human Rights Commission to include a section in the constitution stating that, “everyone has the right to life, physical integrity and the free development of their personhood. Nobody, under any FLUFXPVWDQFHVVKRXOGEHVXEMHFWHG to inhuman, humiliating ordiscriminatory treatment or torture based on their sexual practices. The respect and consideration that any person is entitled to must be extended to all.”] 4 Felipe Rivas, “Travestismos,” in Red Conceptualismos del Sur, eds. Perder la forma humana. Una imagen sísmica de los años ochenta en América Latina (Madrid: MNCARS, 2012), pp. 247-253. 5 Pablo Oyarzún, “La omisión del pronombre,” The Clinic, Santiago de Chile, 10 September, 2013. 6 Grupo Chaclacayo, “Eine Zusammenfassung von Ereignissen, Repressionen und politischen Morden, die während der Arbeit am 3URMHNW¶3HUX«HLQ7UDXP·²*UXSR Chaclacayo – geschahen,” in Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin: Alexander Verlag, 1989), p. 96-101. 7 Severo Sarduy, Ensayos generales sobre el barroco (Buenos Aires: Fondo de Cultura Económica,1987), p. 93. ,QWKHDEVHQFHRIH[SHQVLYHDUPRU\WKH\DUPWKHLUDUWLÀFH with rhetorical gestures and recycled garments sourced LQWKHZDVWHODQGV7KLVSOXUDOWHUPGRHVQ·WVHHNWRGHÀQH a new identity that can simply be added to the list of preexisting identities, but functions rather as an operation WKDWUHYHDOVWKHFRQÁLFWEHWZHHQWKHVH[HVDQGDWWKH VDPHWLPHPDNHVYLVLEOHRWKHUIRUPVRIFUXVDGHVDQG DQRWKHUNLQGRIZDU Analyzing the way in which the display or erasure of the body —or more precisely the corpse— forms part of the management of power is a means of understanding the distribution and functioning of power during the years of terror in Chile and Peru. In Chile, during military dictatorship, state terrorism controlled the population through a FDOFXODWHGVWUDWHJ\RINLGQDSSLQJDUUHVWWRUWXUHDQGWKH systematic disappearance of bodies. Part of the strategy of the disappearances was the denial of the existence of clandestine detention centers —those “secret spaces where the KHLQRXVLVFRPPLWWHGWLPHDQGWLPHDJDLQµ>ÀJ@5 In Peru the power of death was exercised through the gaze of the mass media machine. Domination was produced WKURXJKSRUQRJUDSKLFWHFKQRORJLHVWKDWÀ[HGWKHH\HWRWKH spectacle to the corpse: charred, open, wounded and mutilated bodies that were the product of an internal state of violence in which two groups (Sendero Luminoso [Shining Path] and the Peruvian State) waged war mainly in the territories belonging to peasants and the indigenous population (“94 % of the civilian casualties are indigenous,” notes Grupo Chaclacayo in their chronology of Peru in WKHHLJKWLHV >ÀJ@6 Is it possible that in exhibition and concealment, the transvestite’s games borrow from and subvert the regimes of visibility that this power depends on? Transvestism’s game is one of veiling and unveiling desires. For the transvestite, the clothes are the primary veil that hides and reveals at the same time. The folds of WKHVNLUWFRQFHDOWKHVHFUHWRIWKH¶ORZHUSDUWV·ZKLOHWKH DUWLÀFHSURSRVHVFDVWUDWLRQDQGDWWKHVDPHWLPHFDVWUDtion is denied: “The erection is omnipresent, even in the smoothness of the fabrics, in its softness.”7 Their image conceals while undressing —a salacious appearance that UHYHDOVWKHGHVLUHVRIDERYHDOOWKRVHZKRORRN7UDQV vestism appeals not to our credibility but to our desire: to activate transvestisms would be to exercise power through seduction.8 8 As Pablo Oyarzún shows: “As with nudity and undressing, the dress that both veils and reveals plays inevitably with truth. To dress up and produce an appearance of nudity, or to cross-dress [to transvestize], is to unveil the truth of desire: seduction.” Pablo Oyarzún, Arte, visualidad e historia (Santiago: La blanca montaña, 1999), p. 274. 9 Carlos Pérez, “De la pintada promiscuidad,” in Francisco Zegers, ed. El fulgor de lo obsceno, (Santiago: Francisco Zegers, 1989), p. 46 10 The Chilean art critic Justo Pastor Mellado also points this out. See Justo Pastor Mellado, “El verbo hecho carne. De la vanguardia genital a la homofobia blanda en la plástica chilena,” in Juan Vicente Aliaga, ed. En todas partes. Politicas de la diversidad sexual en el arte (Santiago de Compostela: CGAC, 2009), p. 88. 11 Carlos Perez, “De la pintada promiscuidad”, p. 46. 12 Personal communication with Sergio Zevallos, 19 September, 2013. 13 Personal interview with Sergio Zevallos, Lima, 25 November, 2013. 14 María Lugones, “Colonialidad y género. Hacia un feminismo decolonial,” in Género y decolonialidad The Chilean practices of transvestism rigorously DGKHUHWRWKLVORJLFRIWKHGUHVV7KHVNLUWVLQWKHSHUIRUmance Las dos Fridas [The Two Fridas] (1990), by the duo Yeguas del Apocalipsis [Mares of the Apocalypse] (Pedro Lemebel and Francisco Casas) done at the Galeria %XFFLSHUIRUPVQDNHGQHVVUDWKHUWKDQFRYHUVXS7KH artists presented a re-enactment of the painting Las dos Fridas [The Two Fridas] (1939) by Mexican artist Frida .DKORLQZKLFKWKH\ERWKDSSHDULQVNLUWV+HUH WKHWUDQVYHVWLVPPDNHVH[SOLFLWWKH´HTXDWRULDOOLQHRIWKH waist”9: the border between the upper half, where the masFXOLQHFKHVWLVQDNHGDQGSDLQWHGDQGWKHORZHUKDOIKLGGHQLQWKHIROGVRIWKHVNLUW10 As both bodies simulate a blood transfusion, Lemebel and Casas trace the geography RISRZHURQWKHLURZQERGLHV,IWKHZDLVWVHUYHVWRPDUN the division between “the activities of the (…) industrial North of the body (the mouth, the gaze) and those of the sordid, rundown South of below (the anus and the genitals),”11WKHQWKDWGLYLVLRQZDVLQWHQVLÀHGDQGHYHQPRUH violent for colonized and racialized bodies in the context of the AIDS crisis in the eighties. Lemebel and Casas subvert these hierarchies in their performance by locating the transmission tube in the northern upper part of the body while an opening in the tube drips blood that stains the VNLUWDQGVSUHDGV¶VWLJPD·DOORYHUWKH6RXWK In another action by the Yeguas del Apocalipsis, entitled Casa Particular [Private Home] (1989), the artists VWDJHWKHODVWVXSSHUZLWKWUDQVYHVWLWHVH[ZRUNHUVLQWKH San Camilo neighborhood. The Madame of the brothel, sat in the center of the table, assumes both the pose of Christ and the dictator Pinochet, stating: “this is the last dinner of San Camilo and the last dinner of this government.” Later, after offering bread and wine, she continues, “this is my body, this is my blood.” By introducing transvestites into a PLOLHXRI&KULVWLDQV\PEROLVPDOLQNLVGUDZQEHWZHHQ WUDQVYHVWLVPDQGWKH&DWKROLFUKHWRULFRIVDFULÀFH+HUH WKHERGLHVDUHUHFRJQL]HGDV¶VDFULÀFHGERGLHV·³H[SRVHG to AIDS, economic precarity and murder. Through the transgender body’s performance of the intertwined relationship between Catholic messianism and military authoritarianism, the action announces an end to the dictatorship as well as the brothel. Private Home is a parody of the dictatorship (and the development of the neoliberal hegemony) as a pimp state. 7KHÀJXUHRI6DQWD5RVD>6DLQW5RVH@LQWKHZRUNRI (Buenos Aires: Ediciones del signo, 2008). and expose them to sexual violence and slavery. 15 Lugones demonstrates that the ideologies of the colonizers “prompted them to approach the indigenous populations of the Americas as hermaphrodites.” Later she writes, “if Eurocentric global capitalism only recognizes the dimorphism between white, bourgeois men and women then sexual difference is therefore not based on biology.” Lugones, “Colonialidad y género,” pp. 30-31. 17 Jacques Derrida, “Leer lo ilegible. Entrevista con Carmen GonzálezMarín,” in Revista de Occidente, n. 62-63 (1986), pp. 160-182, KWWSZZZMDFTXHVGHUULGDFRPDU textos/ilegible.htm 7KLVKLHUDUFK\WDNHVRQDFRQWHPSRUDU\VLJQLÀFDQFHZLWKWKHGHYHORSPHQWRIWUDIÀFNLQJQHWZRUNVWKDW capture migrant men and women 18 Pablo Oyarzún, “Para un análisis ÀJXUDOGHOSRGHUµLQ:LOO\7KD\HUDQG Pablo Oyarzún, eds. Archivos 2/3 (2009), pp. 33-52. 19 The ‘tapada limeña’ was a dress that covers the face and was worn by women in Lima. It was transported from Spain (where it was customary dress for Muslim women) during Sergio Zevallos also presents us with a transvestite body that constructs and visibilizes an archeology of power. Yet, if violence in the practices of sexual dissidence in Chile is not made explicit, remaining an allusion through parody DQGEHWZHHQWKHIROGVRIWKHGUHVVLQWKHZRUNRI=HYDOORV there is a serial theatricalization of the pornographic. Zevallos displays a transvestism undressed —a transvestism constructed with traces of feminine clothing (negligées, underwear, a lace dress). This is minimal attire “used as a veil”12 that leaves the masculine sex entirely exposed. Despite this full disclosure it seems the penis has never been more hidden: the veil manages to fetishize as much as unveil. Here the relationship between pleasure and corpse replicates and highlights the particular regime of production of visibility of the body through which terror was being propagated in Peru at the time: masturbation is bloody DQGKXPDQUHPDLQVDUHSHQHWUDWHG>ÀJ@ II. It is strange how in the division of roles —in the negotiation of powers and positions— the masculine perspective is intent on differentiating energies, on dividing them and administrating them. The origin of this is the Catholic Church and Christianity, which promotes and proliferates this rational division of subjectivities and energies and thus ideologically constructs the enemy, the danger, as that part of subjectivity embodied in seduction. Sergio Zevallos13 In the countries of the South, the nodes through which masculine and feminine roles and practices are policed can be traced throughout the colonial system and history of production of gender.14 There is a series of power relations produced at the intersection of gender and race that construct hegemonic notions such as (white) male and female, patriarchy and sexual dimorphism itself. There is also the element of the hidden through which the so-called conquerors of America swept aside all those people with non-white features —those who “weren’t necessarily understood in dimorphic terms.”157KH\ZHUHVXEMHFWHGWRUDSH DQGWKHLUZRUNZDVH[SORLWHG16 /RRNLQJDWWKHPRGHV through which these dichotomies are imposed and culturally established reveals that race and gender are not transKLVWRULFDOFDWHJRULHVEXWSRZHUIXOÀFWLRQVWKDWSURGXFH their own shadows —they carry their own histories and contingencies encoded. 44 colonial invasions of Latin America in the sixteenth century. 20 See Giuseppe Campuzano, “Veiled genealogy for a transfuture,” in Carlos Motta and Runo Lagomarsino, eds. The Future Lasts Forever (Gävle: Gävle Konstcentrum, 2011), pp. 29-37. [Editor’s note: A legacy of WKH0RRUVRU0XVOLPVZKRÁHG persecution in Spain, the ‘tapadas limeñas’ were especially common among the Spanish elite when they ÀUVWDUULYHGLQ3HUXDIWHUWKH6SDQLVK colonization of the Americas beginning in 1492. At the end of the 16th century, the Congress of the Indias saw a potential danger in the veiled women for the colonial empire because the sexual identity of the bod- :LWKLQWKHFRORQLDOÀFWLRQRIJHQGHUWKDWKLHUDU chizes the visible and the hidden, seduction always emerges on the side of the hidden and carries with it the VWLJPDRIIHPLQLQLW\6HGXFWLRQLVDQLQGLVSHQVLEOHVXEMHFW to analyze here because in transvestism, which is also traversed with the colonialism of gender, it is the power to YLVLELOL]HRUKLGHWKDWLVDWVWDNH,QRUGHUIRUWKHUHWREH seduction it is necessary for there to be something hidden as well as something promised: there is seduction “when desire and pleasure are promised but not given, when there is something that hasn’t revealed itself.”17 Seduction is related to the way in which power presents itself as innuendo.18 In seduction there is power, but this is a power that operates abiding by a clear set of game rules: it demarcates and domesticates through the production of ZHDNQHVVDQGWKHPDQXIDFWXULQJRIGDQJHU$QLPDOLW\ promiscuity, impurity, contamination, perversity, heresy, femininity— from the colonial perspective, these are all DWWULEXWHVRIWKRVH¶GDQJHURXV·DQG¶ZHDN·VXEDOWHUQ VXEMHFWVLQQHHGRIGLVFLSOLQLQJ It is precisely through seduction that the subaltern might reclaim agency, despite it being in the shadows, LQWKHGDUN:KHQWKHWUDQVSKLORVRSKHU*LXVHSSH&DPSX]DQRHYRNHV´WKHGHVLUHVLPXODWRUµRIWKH´WDSDGDOLPHxDµ >/LPHDQ9HLOHG:RPDQ@19KHPDNHVHYLGHQWWKHDJHQF\ DQGWKUHDWWKDWWKRVHERGLHVZKRWUDIÀFDPELJXRXVDQG uncertain cultural information across borders bear: “the SURSDJDQGDXQGHUWKH/LPHDQYHLOWKH>:HVWHUQIHDURI@ explosion under the Islamic veil: these are subaltern transvestisms denied speech.”20 However, agency isn’t always emancipating. Sometimes an action restricts alternatives DQGHQGVXSPLQLPL]LQJWKHÀHOGRIDFWLRQZKLFKFDQSURduce a “miserable agency”21 —an agency that damages. 3HUKDSVDV,QGLDQSKLORVRSKHU*D\DWUL6SLYDN SRLQWVRXWWKHVXEDOWHUQFDQQRWVSHDN<HWVLOHQFHZLHOGV a power of its own. It can also be seen, as the philosopher Pablo Oyarzún suggests, as a withdrawal: “the silence of the ‘ladino’ [the colonized] is an art of seduction constructed as an answer to the Colonizer. It is a means RIZLWKGUDZLQJIURPWKHSRVVLELOLW\RIEHLQJHYRNHGDVWKH picturesque, the exotic, the pathetic.” This withdrawal could be a means of saving for the future, of accumulating, of capitalizing. It is also the case that, “within this reserve it is possible to withdraw even further, as if in the middle of an abyss something might come.”22 ies beneath the veil couldn’t be controlled. This reference acts as a precursor for some feminist, queer and trans resistance movements. See &RFR)XVFR´:HZHDUWKHPDVNµ in Ella Shohat, ed. 7DONLQJ9LVLRQV Multicultural Feminism in a Transnational Age (Massachusets: MIT Press,  SSDQGDOVR0LJXHO A. López, ed. Giuseppe Campuzano, Saturday Night Thriller y otros escritos, 1998-2013, (Lima: Estruendomudo, 2013).] 21 I borrow the term from an unpublished text by the poet José Carlos Agüero. The text, entitled Los rendidos. Sobre el don de perdonar, was presented during the sessions “Grupo Memoria” in the Instituto de Estudios Peruanos (IEP), Lima, 24 October, 2013. 22 Pablo Oyarzún, “Identidad, diferencia, mezcla: ¿Pensar Latinoamérica?,” in La desazón de lo moderno. Problemas de la Modernidad (Santiago de Chile: Universidad Arcis/Cuarto Propio, 2001), p. 393. 23 [Editor’s note: On 30 December, 1982 the Peruvian Government delegated powers to the military and the counter-revolutionary struggle with WKHREMHFWLYHRIUHFRYHULQJFRQWURO of various areas of the country. The political authorities failed to activate VXIÀFLHQWPHFKDQLVPVDQGSURWRFROV for the protection of human rights. Abuse was in part a strategy inherent Is there not something of this logic of silence and withdrawal in Grupo Chaclacayo’s retreat from society to an abandoned house? This retreat occurs in 1982: the same year the Peruvian government armed the Southern Andean region as a strategy for confronting the war initiated two years before by The Shining Path.23 Is there not a latent intention to create a sort of minor counter-State, DQDOWHUQDWLYH¶IUHH]RQH·LQRUGHUWRPDNHWKHLPSRVVLEOH occur? For Grupo Chaclacayo withdrawal becomes a PHDQVRIHVFDSLQJWKHQHJRWLDWLRQVRIWKHPDUNHWVRFLHW\·V institutions and the call to the heterosexual family. Their retreat was a way of creating subversive counter-practices and other sexual-affective relationships. They sought the dismantling of the established system of love between two people and experimented with the creation of relationships between three that, with their own complexities and failures, UHYHDOHGRWKHUSRVVLEOHIRUPVRIHURWLFDIÀQLWLHV7KH\QHDUO\ managed to escape entirely was it not for the exhibition at the Lima Art Museum in 1984: the moment when, in the IDFHRIWKHRIÀFLDOFHQVRUVKLS RUYHLOLQJ RIWKHLUZRUNLQ the museum, “the public lifted up the veil”.24 III. (YHU\WKLQJZLWKRXWDPDVNDYHLODFRYHULVSDUWRIWKH operation of sex and death— all of this can be called obscene and pornographic. Jean Baudrillard25 It is through the transvestite game that the distribution of energies and roles across the hierarchy of the masculine DQGWKHIHPLQLQHFDQEHGLVRUJDQL]HGWDNHQDSDUWDQG reformulated. As part of the performance La Biblia [The %LEOH@ZKLFKWRRNSODFHDWWKH&KLOHDQ)UHQFK,QVWLWXWH in Santiago in 1982,26 Juan Domingo Dávila presents two images: La Biblia de María Dávila [Maria Dávila’s Bible] and /LEHUDFLyQGHOGHVHRɀ/LEHUDFLyQVRFLDO [Liberation of Desire ɀ6RFLDO(PDQFLSDWLRQ@>ÀJ@ In Maria Dávila’s Bible (1982) a photograph shows WKHDUWLVWGUHVVHGDVDYLUJLQVDLQWXVLQJ&KLOHDQÁDJDVD YHLO7KHFKDUDFWHUKDVWKHIDFHZKLWHQHGZLWKPDNHXS the lips painted red and the left arm extended in a salute. Scribbled over the image says, “Reina de Chile/ Pan nuestro” [Queen of Chile/ Our bread]. ‘Queen of Chile’ is a reference to the Virgin Carmen: a virgin saint of colonial origin who was declared patron saint of the army during to military practices. See Comisión de la Verdad y Reconciliación, Informe Final (Lima, CVR, 2003).] 24 The only exhibition of the Grupo &KDFODFD\RLQ/LPDWRRNSODFHDWWKH Lima Art Museum in 1984. Various ZRUNVE\=HYDOORVDQG$YHOODQHGD were initially censored when the authorities at the German embassy FRYHUHGWKHDUWZRUNVLQEODFNIDEULF for the opening of the exhibition. In response, “the public lifted up the veils” during the exhibition. Miguel Silvestre, “A propósito de una muestra de ‘Chaclacayo’: Cuando el ser auténtico resulta ser peligroso,” in (O'LDULR0DUND Lima, 27 November, 1984, p. 18. See English translation in pages 138-139. 25 Jean Baudrillard, De la seducción (Madrid: Ediciones Cátedra, 1986). 26 Carlos Leppe, Juan Domingo Dávila and Nelly Richard participated in the performance. Juan Domingo Dávila and Nelly Richard staged a live version of La Pietá, in which 'DYLODWRRNRQWKHUROHRIWKHPRWKHU and Richard the child. A video played simultaneously showing a second staging of the scene of La Pietá, this time with another man occupying the place of Richard —thus alluding to a (homo)sexual relationship. Later, Carlos Leppe enters the scene dressed in a suit and reads a text about its position in the Chilean art scene. the Republic. During the dictatorship years Virgin Carmen ZDVDSSURSULDWHGDVDQLFRQRIRIÀFLDOPLOLWDU\FXOWXUH+HU ÀJXUHHYRNHVQRWRQO\WKHLPSRVLWLRQRIWKHFRORQLDOV\VWHP of gender and sex on the continent but also functions as an emblem of the genocide of the indigenous population in the Spanish collective imagination. In Maria Dávila’s Bible Saint Carmen is transformed through transvestism as well as the decontextualized salute —a gesture that traditionally HYRNHVWKHWKUHDWRILQVXUJHQF\LQWKHYLVXDOFXOWXUHVRIWKH OHIW7KHLPDJHIRUJHVDOLQNEHWZHHQWKHQDWLRQDOFDWKROLF visual discourses and those of the left (both with their heteronormative violence and inherent homophobia). The image also refers to their cooperation during the Chilean military dictatorship when the left entered into a political relationship with the Catholic Church who had raised concern regarding the military repression of citizens. In this sense Dávila’s image ironizes the left’s discourse and parodies their notion of emancipation in this case adopted as a question of faith. And yet, the biggest threat of this image is not so PXFKWKHFOHQFKHGÀVWEXWUDWKHUWKHSDLQWHGOLSVZKLFK point to the clear replacement of the virgin-mother with a virgin-prostitute. The representation of the virgin-mother in possession of a sexuality initiated, as the philosopher Patricio Marchant suggests, an emancipatory process occurring through the presentation of “a Latin American 6DLQW«DIÀUPHGDVD6DLQWIUHHIURPWKHODZRIWKHIDWKHUµ27 In the second image, accompanied by the label ´/LEHUDFLyQGHOGHVHRɀ/LEHUDFLyQVRFLDOµ>/LEHUDWLRQRI Desire ɀSocial Emancipation], Dávila displays a portrait of KLPVHOIXQFRYHUHGDQGZLWKRXWPDNHXS7KHÁDJYHLODQG wig used in the previous image have now fallen and rest on his bare chest and shoulders. The right arm is folded and raised over his head performing a rhetorical erotic-feminine JHVWXUHWUDQVIRUPLQJWKHWKUHDWRIWKHFOHQFKHGÀVW+HUH 'iYLODWZLVWVWKHÀVWHGVDOXWHRIWKHPLOLWDQWOHIWZLQJDQG LQYRNHVLQVWHDGDQLPDJHRIÀVWIXFNLQJ (the discarding of the penis and the employment of the two repre-ssed and DEMHFWVH[XDORUJDQVRIWKHDQXVDQGWKHKDQG 7KLVLPDJH can be understood as an unveiling of the system intent on repressing transvestism’s simulacra in order to restore a supposedly pre-existing masculinity. However, the falling RIWKHÁDJYHLODQGWKHUHPRYDORIWKHPDNHXSUHYHDO transvestism’s NQRZOHGJH that every revelation is always DFWXDOO\DPRPHQWRIFRYHULQJXSWKHXQYHLOLQJRQO\ HYHUDSXOOLQJXSRIWKHYHLO+HUHDPDNHXSIUHH'iYLOD 27 Patricio Marchant, “Sobre el uso de ciertas palabras,” in Pablo 2\DU]~QDQG:LOO\7KD\HUHGV Escritura y Temblor (Santiago: Editorial Cuarto Propio, 2001), p.76. 28 [Translators note: The verb ‘to transvestize’ has been chosen here instead of the verb ‘to drag’ because of the distinct histories and uses of the terms.] ,WKDQN6HUJLR=HYDOORVIRUGUDZLQJ attention to this second moment of WUDQVYHVWLVPDWZRUNLQWKLVLPDJH which he mention during the presentation for the exhibition Un cuerpo ambulante in the Lima Art Museum on 15 December, 2013. 6ODYRM=L]HNA propósito de Lenin. Política y subjetividad en el capitalismo tardío (Buenos Aires: Atuel/Parusía, 2004). 31 The most violent example of this is perhaps not so much the failed attempt to censor Grupo Chaclacayo’s show in 1984, but the accusation launched by art critic Luis Lama against the Grupo Chaclacayo. In a review article the critic proposed that WKHLUZRUNZDVDQDSRORJ\IRU6HQGHro Luminoso. At that time an accusaWLRQOLNHWKDWFRXOGKDYHKDGJUDYH effects on the lives of the members of the group. See: Luis Lama, “Perversión y complaciencia,” in Caretas, Lima, 20 November, 1989, pp. 74-76. transvestizes28 the previous image of Maria-Dávila by WZLVWLQJKLVFOHQFKHGSKDOOLFÀVW29)LVWIXFNLQJDSHQH tration without fertilization –neither of the body, the conscience or the nation– the pure expenditure of the PDOHERG\WKDWDIÀUPVLWVHOIDVSHQHWUDEOHOLNHDQ\RWKHU 0HDQZKLOH6HUJLR=HYDOORVWUDQVYHVWL]HVWKHÀJXUH of Saint Rose of Lima: a character that represents a whole pedagogy of sexual repression imposed by oneself on oneself. The dominant ideological catholic narrative of Saint Rose is that although she was of mixed-race origins, she ZDVUHPDUNDEO\HTXLSSHGZLWKDSXUHZKLWHQHVV,QWKH WUDGLWLRQDOVWRU\VKHLVVHOIÁDJHOODWLQJZKLFKHOHYDWHVKHU mystical ecstasy as an exemplary model of behavior. In the ZRUNVRI=HYDOORV6DLQW5RVHDSSHDUVDVDK\EULGEHLQJ victim and executioner, abused and abuser. She becomes DIDLWKIXOZLWQHVVRIWKHGLVFLSOLQDU\DSSDUDWXVWKDWVHHNV to purify the body of excess and return it chaste, productive and useful. However, the dominant discourse doesn’t propose the masochistic pleasure that comes with self-punishment. They omit the fact that there exists a counter-pedagogy in the ambivalences of masochism: “masochistic torture frustrates the sadist because it deprives him of his power. Sadism implies a relation of dominance while PDVRFKLVPLVWKHÀUVWVWHSQHFHVVDU\IRUHPDQFLSDWLRQµ30 7KHWUDQVYHVWLWHUHFRGLÀFDWLRQRI6DLQW5RVHDV she appears in the series Rosa Cordis (1986) [Rose Cordis] >ÀJ@WHQGVWREHVHHQDVRIIHQVLYHSUHFLVHO\EHFDXVH LWPRFNVWKHRIÀFLDOUHOLJLRXVLFRQRJUDSK\DQGH[SUHVVHV DQXQVSRNHQFRPSOLFLW\EHWZHHQWKHUKHWRULFRIQDWLRQDO catholic-colonial discourse and the terrorism of the state. 7KLVLVDQRSHUDWLRQWKDWSURYRNHVSURKLELWLRQLQUHVSRQVH It is the logic of heresy: where censorship and stigma feel OLNHKRPH31:KDWWKHFRQVHUYDWLYHGLVFRXUVHFRXOGQ·WVHH was that the intolerable nature of these images was rather WREHUHDGEHWZHHQWKHOLQHVWKHVWDWHLWVHOIHQMR\VD sadist pleasure through the transgression of the law whenever it carries out illicit acts that entail the reduction of the body to pure animality. Torture can be thought of as DSHUYHUVHPHFKDQLVPRIVXEMHFWLÀFDWLRQWKURXJKZKLFK individuals identify with the nation-state and violence itself is turned into the very thing that constitutes citizenship.32 In the series Detritus (1986), a transvestized Saint Rose is presented in her role as the victim. From inVLGHDEXULDOFRIÀQWKHÀJXUHRI6DLQW5RVHHPHUJHVDVD ‘swooning relic’, covered in a shroud: an uncorrupted body, YHLOHGDQGVHGXFWLYH>ÀJ@7RWHDUWKHVKURXGRUWRSXOO 46 32 Similarly, culture critic Victor Vich proposes that, “the nation VWDWHPDNHVFRQWDFWZLWKLWVFLWL]HQV through torture, forcing them to SDUWLFLSDWHLQDGLVFLSOLQDU\SURMHFW that consists of an obscene identiÀFDWLRQZLWKSDLQµ9LFWRU9LFK (OFDQtEDOHVHO2WUR9LROHQFLD\ cultura en el Perú contemporáneo (Lima: Instituto de Estudios Peruanos, 2002), p. 55. 33 Zevallos, “Der Obszöne Tod,” p. 4. 34 Silveste, “A propósito de una muestra de ‘Chaclacayo’,” p. 18. 35 Ibid. away the veil is to rip the hymen— the veil reveals itself as the sign of the complicity between fetishism and necrophilia, whose relationship can be traced throughout colonial discourse and practice. If the patriarchal fantasy reconstitutes itself through the Saint Rose myth and its propagation of racial and moral whitening through embodied purity, the DetritusLPDJHVVKRZWKHDUWLÀFLDOFRQVWUXFWLRQRI that myth and display the promiscuous fall of the saint LQWRZDVWH7KHFDOORIWKHSXUHWKDWVHHNVWRVXSSUHVV DQGSXQLVKWKH¶GLUW\·ZRQ·WDFKLHYHWKLVKRO\HOLPLQDWLRQ LWMXVWGLVSODFHVLWLQWRDGHVLUHIRUWKHFRUSVH2UDV Zevallos shows in the death of Saint Rose,“the people are eager to posses her helpless body as soon as she has passed away.”33 One of the images of this series shows a half-burLHGERG\O\LQJMXVWEHORZWKHFRIÀQRI6DLQW5RVH>ÀJ@ 7KHREVFHQHYLVLELOLW\RIWKLVERG\³LWVWRWDOREMHFWLÀFDWLRQ³ echoes the many images of mass burial sites, of unburied bodies and hidden cemeteries found during the armed FRQÁLFWLQ3HUX%XWWKLVO\LQJERG\DOVRUHFDOOVWKHLQGL genous cemetery —for what else could be lying under the tomb of a colonial saint? In an interview in 1984, Zevallos explains how the underside of the Limean Saint is the violated body of the LQGLJHQRXV´:KLOH6DLQW5RVHVHOIÁDJHOODWHVDQGSURGXFHV SK\VLFDOSDLQWKDWZLOOEHWUDQVPRJULÀHGLQWRP\WKLQWKLV country they torture and destroy bodies for whom there is no mercy.”347KHIDFHRIWKHWUDQVYHVWLWHÀJXUHRI6DLQW 5RVHDOZD\VDSSHDUVLQPDNHXSVKHLVDFKDUDFWHUFDXJKW between the prostitute and the virgin suggesting a history of Peru that lies between hagiography and the brothel. Yet, LQWKHZRUNVDetritus and Rosa Cordis the subaltern bodies appear as bodies without faces7KDWLVDERG\WKDWHYRNHV an “animality previous to the human” (according to philosopher Emmanuel Lévinas, animals have no face).35 The question is where the dividing line is between the human DQGWKHRWKHU,WLVDOZD\VSRVVLEOHWRVD\´:HDUHQRW animals, we demand respect!”36 However, a re-reading of the colonial animalization of the indigenous should warn that the distinction between human and animal is inherently political and acquires multiple physiognomies in order to MXVWLI\WKHVDFULÀFHRIWKHRWKHU7KLVPLJKWEHWKHKRUURU SURYRNHGE\WKHGRJVVSOLFHGRQSROHVLQ/LPDDWDFWLF used by Shining Path during the early years of the insurgency. On the other side, it might be the crying and resisWDQFHRIWKHSHDVDQWZRPHQWRWKHNLOOLQJRIOLYHVWRFNE\ 36 Ana Penchaszadeh, “Democratize the problem of hospitality. Deconstruct the concept of unconditional hospitality.” This was a conference paper presented at “Current Debates in Contemporary Politics” in Buenos Aires, 2010. 9LFWRU9LFKWHOOVRIWKHWDNHRYHU RI$OOSDFKDNDE\DJURXSRI6HQGHUR Luminoso supporters. This was an estate founded by the National University of San Cristobal of Humana in Ayacucho to train farmers and DJULFXOWXUDOZRUNHUV$VVRRQDV the representatives of Shining Path WRRNKROGRIWKHVWDEOHVWKH\EHJDQ shooting indiscriminately at the aniPDOV:KHQWKHOLYHVWRFNEHJDQWR fall to the ground, the farmers began to cry. For Vich, the cry of the agriculWXUDOZRUNHUVGHPRQVWUDWHGDQ “an alternative meaning of animal ³UHVWRULQJDOLQNZLWKWKHKXPDQµ Vich, El caníbal es el Otro, p. 41. 38 Marchant, “Sobre el uso de ciertas palabras,” p.79. 39 In his analysis about masoquism, Deleuze has proposed this operation ZKHQKHDQDO\]HVWKHÀJXUHRIWKH masochist: “The contract puts the law of the father in the hands of the mother. But this transference is uniquely effective: in her hands the entire law is transformed, and where as before she would veto the power now she organizes it. Those who would have forgiven now transform UHSUHVHQWDWLYHVRI6KLQLQJ3DWKLQ$OOSDFKDND37:KDW is perceived here is a zone of indistinctness that disturbs the borders between animal and human. So, how does this strategy of queer disruption of IHPDOHDQGPDWHUQDOUHOLJLRXVÀJXUHVRSHUDWHDVDEHWUD\DO RIWKHRIÀFLDOGLVFRXUVHDQGRIIHUDFRXQWHUUHSUHVHQWDWLRQ of the heteronormative and colonial structure of producing VXEMHFWLYLW\":KDWGRHVLWVD\VSHFLÀFDOO\LQWKHFRQWH[WV of Peru and Chile? In their critique of the heteronormative and colonial ideology, the operations that these artists initiate are both matriarchal and matricide at the same time. Their practices LQWHUYHQHLQWRWKHZHVWHUQÀJXUHRI¶ZRPDQ·DV¶PRWKHU· However, they also intervene into the representations of motherhood as a position of power that exercises control over behavior and habits through the transmission of ODQJXDJHPRUDOLW\DQGLGHRORJ\7RWDONDERXW¶WKHPRWKHU· LQ/DWLQ$PHULFDLVWRWDONDERXWDÀJXUHFRQVWUXFWHGRQD ZKROHSRZHUNQRZOHGJHDSSDUDWXVWKDWWDNHVLWVLGHDOIURP the catholic-colonial representations of virgins and saints: austere images of a chaste, obedient and disciplined woman. Confronting this, Dávila and Zevallos’ images introduce an exasperated eroticism and violence to the virgin-mother. The way in which these images forcefully degrade and dismantle the mother is, “a violent transgression of the Latin American discourse, a discourse that culminates not as a European discourse with the one god as the father but rather a matriarchal system of represenWDWLRQSURGXFHGDURXQGWKHÀJXUHRIWKHJRGGHVVPRWKer”.387KHZRUNVZDUQWKDWWKHFDWKROLFFRORQLDOLGHDORIWKH virgin-mother also suggests the opposite: the repressed, VXEWHUUDQHDQGDUNVLGHRIWKHVH[XDOPRWKHU7RWUDQVJUHVV the symbolic power of the father towards a sexual mother doesn’t happen without consequences.39 Its effect is disorientating: in the representations of the Pieta produced by the Grupo Chaclacayo (La agonía de un mito maligno [The $JRQ\RID0DOLJQDQW0\WK@FD >ÀJ@DQG-XDQ Domingo Davila (La Biblia [The Bible], 1982) , they re-write a mother-child relationship as a (homo)sexual relationship and one where the father has no place.40 These images thus disturb the prohibition of incest as an organizing principle of identity and heteropatriarchal forms of alliance41DVZHOODVRSHQXSDÀHOGRILQWHOOLJLELOLW\ FDSDEOHRISURGXFLQJQRQQRUPDWLYHPRGHVRIDIÀOLDWLRQ and sexual-affective partnerships. guilt into innocence, punishment becomes permissible for that which was previously allowed.” Gilles Deleuze, Presentación de SacherMasoch. Lo frío y lo cruel, (Buenos Aires: Amorrortu, 2008), p.105. 40 This is a gesture that perhaps allows a pre-colonial past to intervene in the present. Referring to the androgynous theogony previous to the colonial invasion, Giuseppe Campuzano reminds that, “the analysis of the Andean myths of origin open up this unity towards the mother-child coupling, while the FRQMXJDOFRXSOH MXVWOLNHWKHÀJXUH of the father) are absent. Thus, the two powerfully regulated prohibitions (incest and patricide) and the conse- quent paternal traditions are totally XQNQRZQ7KHVHSURSRVLWLRQVFRQ stitute an alternative symbolism from Lacan’s where patriarchy is always the inevitable.” Giuseppe Campuzano, “Andrógino,” in Museo Travesti del Perú, p. 84. that not all forms of incest are necessarily traumatic (brother/sister incest in eighteenth century literature, for instance, sometimes appears as idyllic).” Judith Butler, Undoing Gender 1HZ<RUN5RXWOHGJH  p. 159 43 The action was conceived as a tribute to Sebastian Acevedo: the PDQZKRVHWÀUHWRKLPVHOIDVD protest against the disappearance of KLVFKLOGUHQ7KHSURWHVWWRRNSODFH in the Plaza de Armas de Concepción in Chile in November 1983. 41 As Butler shows, “to the extent that there are ways of loving that are prohibited, or, at least derealized by the norms established by the incest taboo, both homosexuality and incest qualify as such forms. In the former case, the derealization leads to a ODFNRIUHFRJQLWLRQIRUDOHJLWLPDWH ORYHLQWKHODWWHUFDVHLWOHDGVWRD ODFNRIUHFRJQLWLRQIRUZKDWPLJKW have been a traumatic set of encounters, although it is important to note 42 It is important to remember that it was precisely in an abandoned limestone mine in Lonquén in 1978 ZKHUHWKHÀUVW¶GLVDSSHDUHG·SHRSOH NLGQDSSHGDQGH[HFXWHGE\WKH state) were buried during the Pinochet dictatorship. The headline was made public immediately, constituWLQJWKHÀUVWHYLGHQFHWKDWWKHGLVDSpeared were dead. 44 Personal communication with Zevallos, 19 September, 2013 IV. The introduction to this text addressed the ways in which the regulation of media representations of the body or the corpse is a form of administering terror. The counterpoint would be the processes of exhumation that silently pursues the search for those bodies who have been GHQLHGMXVWLFHDQGPRXUQLQJ$QRWKHUÀJXUHDSSHDUVLQ WKHLPDJHVEHWZHHQWKHVHÀJXUHVRIVH[XDOGLVVLGHQFH WKHERG\EXULHGLQTXLFNOLPHHPHUJHVLQWKHZRUNDV a sign of that negation of rights and as a denouncement RIWKHGHJUDGDWLRQRIWKHVHERGLHV4XLFNOLPHDVDQ apparatus of social hygiene as much as a technology for the annihilation of any trace of the crime, is a direct symbol of terror.42 In Homenaje a Sebastián Avecedo [A Tribute to Sebastián Acevedo] (1993) the Yeguas del Apocalipsis use TXLFNOLPHDVDSULPHPDWHULDOLQWKHZRUN>ÀJ@43:KLOH UHFLWLQJWKHQXPEHUVRIGRFXPHQWVRILGHQWLÀFDWLRQDQG GLIIHUHQWWRZQQDPHVLQ&KLOHERWKDUWLVWVDUHO\LQJGRZQ QDNHGDSDUWIURPTXLFNOLPHWKDWFRYHUVWKHLUVNLQ ZKHQLQ FRQWDFWZLWKWKHKXPLGLW\RIWKHVNLQWKHFKHPLFDOFRPSRXQGSURGXFHVPLOGVNLQEXUQV 7KHLUERGLHVDSSHDU QDPHOHVV³WUDQVIRUPHGLQWRDQRQ\PRXVÀJXUHVDQXPEHU LQDPDVVJUDYH7KHTXLFNOLPHSHUIRUPVWKHULWXDOLVWLF method of getting rid of the ‘Marxist cancer’ –as dictator Pinochet called the leftist movements– and all those who resisted the dictatorship. It also suggests the social cleanVLQJRIWKHERGLHVLQIHFWHGZLWKWKHVRFDOOHG¶SLQNSODJXH· (AIDS). Here the Yeguas del Apocalipsis intervene into the representation of victims of the dictatorship with an image of a homosexual who is eroticized and at the same time stigmatized by sexuality. The series of photos Entierro de cal>7KH4XLFNOLPH Burial] (1986-1987) portrays an anonymous character dressed as a “white veiled body”, who performs the act of spraying, covering and burying another body with TXLFNOLPH>ÀJ@7KHO\LQJERG\LVQDNHGZLWKWKHOHJV opened out: “A body in surrender— in the sexual sense of the word as well.”44,QWKHDFWLRQWKH¶YHLOHGERG\·HYRNHV WKHIHPLQLQHEXWXQOLNHRWKHUZRUNVE\=HYDOORVZKHUHWKH WUDQVYHVWLWHLVWKHSURWDJRQLVWWKHREMHFWRIGHVLUHLVWREH found here in the male body that lies face down hiding his masculine genitalia. The man becomes androgynous and the gender boundaries are confused once again. This is a ERG\WKDWLVFRYHUHGLQTXLFNOLPHDQGODWHUXQFRYHUHGWLPH 45 Sarduy, Ensayos Generales sobre el barroco, p. 87 46 At the beginning of the action the body is only partially covered, later becoming entirely buried in WKHTXLFNOLPH 47 Personal interview with Sergio Zevallos, Lima, 25 November, 2013. and time again. In the cold theatricality of the image, it is practically the opposite of the lustful burial of Saint Rose staged in Detritus. 7KHTXHHUERG\FRYHUVLWVHOIZLWKTXLFNOLPHDVDQ index of the horror. But to understand this procedure anRWKHUWUDQVPXWDWLRQPXVWEHUHFRJQL]HGWKHTXLFNOLPHLV XVHGDVDSLJPHQWDVDQHURWLFL]HGRUQDPHQWDVPDNHXS $FFRUGLQJWRZULWHU6HYHUR6DUGX\PDNHXSWDWWRRLQJDQG torture all have something in common: they all “belong to the same practices of dismembering and fragmenting. 3DLQDQGLQNPDUNRXWDSDUWRIWKHERG\DQGODWHUVHSD rate it as an image apart from the rest of the whole”.45 In both Yeguas del Apocalipsis and Zevallos’ action, the TXLFNOLPHas pigmentHYRNHVWKHORJLFRIIHWLVKLVWLFIUDJmentation while simultaneously suspending it.46 It is not only a part but also the entire body that is highlighted and so coldly sexualized. This is how the traces of gender beFRPHDPELJXRXVXQGHFLGDEOHVXEYHUWLQJWKHÀ[HGVH[XDO roles. Something unique is happening here: “The possibility of recovering, because that is in the end what this is about, a seduction that expand itself in amorphous and vague ways —not only between the genders but also between the ages.”477RHURWLFL]HDEMHFWLRQLPSOLHVDQRSHUDWLRQWKDW transforms cruelty into ecstasy —cold ecstasy. Translated by Rebecca Close Fernanda Carvajal (Santiago de Chile, 1982) Sociologist, researcher and teacher. Grant holder of CONICET. She is Ph.D. student in Social Sciences at the Universidad de Buenos Aires (UBA) in Argentina. She was professor at Universidad Católica of Chile and Universidad de Buenos Aires . She is co-author of Nomadismos y Ensamblajes. Compañías teatrales en Chile, 1990-2008 (Cuarto Propio, 2009). She published essays on art, WKHDWHUDQGVH[XDOGLVVLGHQFHLQVHYHUDOPDJD]LQHVDQGERRN Since 2009 she is a member of Red Conceptualismos del Sur, and she was part of curatorial team of Losing the human form. A seismic image of Latin America in the 1980 at the Museo Nacional Centro de Arte Reina Sofía, Madrid (2012-2013). 48 49 Hacer el amor con el cuerpo de la necropolítica: la práctica artística del Grupo Chaclacayo en los límites de la soberanía Beatriz Preciado Making love to the necropolitical body: the artistic practice of Grupo Chaclacayo at the limits of sovereignty 50 51 Fig. 32 Sergio Zevallos (Grupo Chaclacayo), de la serie Algunas tentativas sobre la Inmaculada Concepción I, 1986. Inyección de tinta sobre papel Hahnemühle. 50 x 37 cm. Fig. 35 Sergio Zevallos (Grupo Chaclacayo), de la serie Celdas, 1985 -1987. Copias a la plata sobre papel baritado. 50 x 37 cm. Fig. 36 Sergio Zevallos (Grupo Chaclacayo), Ambulantes de la serie Suburbios, 1983. Copia a la plata en papel baritado. 14 x 9 cm. Fig. 34 Sergio Zevallos (Grupo Chaclacayo), de la serie Rosas, 1982. Carbón y tiza de color sobre papel. 69 x 89 cm. Fig. 33 Sergio Zevallos (Grupo Chaclacayo), de la serie Estampas, 1982. Carbón, tiza y collage sobre fotocopias en blanco y negro. 33.3 x 21.5 cm. Fig. 37 Faith Wilding, 6DFULÀFH. Instalación realizada y exhibida en el Estudio del Programa de Arte Feminista, Fresno, California, 1971. Cortesía de la artista. 52 53 1 Utilizaré aquí el término necropolíWLFDDXQTXH)RXFDXOWSUHÀHUHODUDt] griega tanatopolítica. Ver Michael Foucault, Vigilar y Castigar, El nacimiento de la prisión (Buenos Aires: Siglo XXI editores, 1976); Hay que defender la sociedad: curso del Collège de France 1976 (Madrid, Akal, 2003). 4 Marcos López en Revuelta(s), película de Fredi Casco y Renate Costa (Fondation Cartier, 2014). 2 Achille Mbembe, “Necropolitique,” en Raisons Politiques, n. 21 (2006), pp. 29-69. Traducción: Achille Mbembe, Necropolítica (Barcelona: Melusina, 2011), p. 24. 3 Achille Mbembe, Necropolítica, p. 31. Fig. 38 Nancy Spero, Bomb shitting [Bomba cagando], 1966. Gouache y tinta sobre papel, 86.1 x 69.2 cm. Marieluise Hessel, Hessel Museum of Art, Center for Curatorial Studies, Bard College, Annandale-on-Hudson, Nueva York Art. © Nancy Spero, APSAV, Lima, 2014. Fig. 39 “La Macarena” de Ocaña en procesión por las calles de Barcelona. Stills de la película “Ocaña, retrat intermitent” (1977), dirigida por Ventura Pons. Fig. 40 Jürgen Klauke, Self Performance (I.L.M.), 1972-1973. Fotosecuencia de 13 piezas. 114 x 300 cm. Kla/f720004. Cortesía Galerie Elisabeth & Klaus Thoman Innsbruck/Wien. Foto © Galerie Elisabeth & Klaus Thoman/ Jorit Aust. Entre los años 1982 y 1994, el Grupo Chaclacayo (Helmut Psotta, Raúl Avellaneda y Sergio Zevallos) OOHYDDFDERXQDGHODVUHÁH[LRQHVSOiVWLFDV\SHUIRUPDWLYDVPiVDJXGDVDFHUFDGHOIXQFLRQDPLHQWR GHODQHFURSROtWLFDHQODVVRFLHGDGHVSRVWFRORQLDOHVGHVXVUHODFLRQHVFRQODVPiTXLQDVGHVHPLRWL]Dción mítico-religiosas y de su metabolización sensorial y sexual a través del cuerpo social. En su genealogía de las relaciones de saber/poder en la modernidad, Foucault describe la necropolítica (o tanatopolítica) como la forma de gobierno que caracteriza a los regímenes soberanos. Se trata de un ‘arte de gobierno’ cuyas formas de producción de verdad y de legitimación son WHRFUiWLFDV\TXHVHH[SUHVDFRPR¶SRGHUGHGDUODmuerte’.1 He aquí la implacable lógica de las formas soberanas de gobierno: en la necropolítica el poder es violencia, el cuerpo (verdugo o víctima) es un cuerpo para la muerte y la subjetividad (dominante o subalterna) se construye a través del terror. Aunque Foucault imaginó que tras la revolución francesa y la derrota del poder soberano \PRQiUTXLFRVHDO]DUtDQHQHOVLJOR;9,,,QXHYDVIRUPDVGHJRELHUQRTXH\DQRVHFDUDFWHUL]DUtDQSRU la gestión de la muerte, sino por la maximización de la vida de las poblaciones (biopolítica), resulta hoy FDGDYH]PiVFODURTXHODVIRUPDVQHFURSROtWLFDVGHJRELHUQR\ODVQXHYDVIRUPDVGHJHVWLyQGHOD vida se articularon durante los procesos de colonización de América en un esfuerzo por maximizar la H[SORWDFLyQHFRQyPLFD\FRQWURODUORVSURFHVRVGHUHSURGXFFLyQVH[XDO\VRFLDO(OÀOyVRIRFDPHUXQpV $FKLOOH0EHPEHOOHYDORVDQiOLVLVGH&DUO6FKPLWW\)RXFDXOWKDVWDHOFRQWH[WRGHODFRORQL]DFLyQ\ describe de este modo el ‘imaginario de la soberanía’ de los Estados racistas en los que la violencia se convierte en el único instrumento de gobierno: la “fusión completa de la guerra y de la política, (…) la percepción de la existencia del Otro como un atentado a mi propia vida, como una amenaza mortal o un peligro absoluto cuya eliminación biofísica reforzaría mi potencial de vida y de seguridad”.2 Es posible entender la década de los 80 en la sociedad peruana, en la que el Grupo Chaclacayo vive, actúa y produce, como un momento de despliegue extremo de las formas necropolíticas del poder, marcado por la guerra entre el ejército del Estado peruano y la organización maoísta Sendero Luminoso, y en el que las técnicas de la muerte (tortura, delación, extensión social GHODLPiJHQHVGHO¶HQHPLJR·RHO¶WUDLGRU·GHVDSDULFLRQHVPXWLODFLRQHVIRVDVFRPXQHV« VDWXUDQ WRGRHOiPELWRGHORSROtWLFR$TXtWDQWRHODJHQWHPLOLWDUHVWDWDOFRPRHOKpURHGHODPRGHUQLGDG marxista “son fundamentalmente sujetos que intentan demostrar su soberanía mediante la lucha a muerte.”3 La necropolítica del Perú no se caracteriza, sin embargo, por la ‘industrialización de la muerte’ típica del nazismo centroeuropeo y de la ‘racionalidad del terror’ de los ‘civilizados’. En la situación post- o neo-colonial el ejercicio mismo de la violencia se ve afectado por los vectores de HFRQRPtDH[WUDFWLYLVWDODGHXGDH[WHUQDODRSUHVLyQÀQDQFLHUDHOOODPDGRHVWDGRGH¶VXEGHVDUUROOR· y la pobreza. En el ‘Sur’ incluso las técnicas de la violencia se ven moduladas por esa variable que el artista argentino Marcos López denomina la ‘poética de lo mal hecho’.4 En el Trópico, hasta la necropolítica se vuelve cutre. Para entender la obra del Grupo Chaclacayo y su relación con el funcionamiento del poder soberano-colonial me parece necesario añadir dos elementos de género y de sexualidad 5 Con sadeanosPHUHÀHURDUHODFLRnados con el imaginario de los textos y proyectos arquitectónicos del Marqués de Sade, frente a la noción freudiana de ‘sadomasoquismo’ TXHSUHWHQGtDGHÀQLUXQDSDWRORJtD sexual. 54 55 H[SORUDGRVLQVXÀFLHQWHPHQWHSRU)RXFDXOW\0EHPEH(QSULPHUOXJDUODIRUPDFDUDFWHUtVWLFDGHO SRGHUVREHUDQRFRORQLDOQRHVVLPSOHPHQWHHOJRELHUQRPRQiUTXLFRRLPSHULDOVLQRHOpatriarcal. (OVXMHWRVREHUDQRVHGHÀQHDQWHWRGRFRPRXQFXHUSRYLULOLPSHQHWUDEOHKHWHURVH[XDO'HOPLVPR PRGRODVDQJUH\HOVHPHQVRQHQWHQGLGRVFRPRÁXLGRVVREHUDQRVDWUDYpVGHORVTXHHOSRGHUVH H[SUHVD\VHWUDQVPLWH(VWRVLJQLÀFDTXHHOSDGUHHVSDGUHQRSRUHOSRGHUGHGDUODYLGDVLQRSRU HOSRGHUGHGDUODPXHUWH'HDKtTXHHOSDGUHHOYDUyQHOVROGDGRSHURWDPELpQHOKpURHPDU[LVWD revolucionario necesiten actuar como operadores de la muerte (diseminadores de sangre y semen) para reclamar su soberanía. El segundo elemento, igualmente crucial en el trabajo del colectivo peruano, tiene que ver FRQODQRFLyQPRGHUQD\FLHQWtÀFDGHraza²TXHVHUYLUiSDUDOHJLWLPDUDSDUWLUGHOVLJOR;9,,HOSURFHVR de colonización y la economía del esclavismo–. Si bien es cierto que esta noción emerge en un contexto de gestión biopolítica de las poblaciones, es necesario tener en cuenta que las políticas raciales se acompañan de un conjunto de estrategias de exterminio cuando se trata de gestionar las llamadas UD]DV¶LQGtJHQDVQHJUDV\SULPLWLYDV·/DSXULÀFDFLyQUDFLDOGHOFXHUSRHQORVHQFODYHVFRORQLDOHVTXH se caracterizó por la gestión biopolítica del cuerpo blanco heterosexual necesitó complementarse con un conjunto de técnicas de la muerte que asegurasen el sometimiento y control reproductivo del FXHUSRQREODQFR\QRKHWHURVH[XDO$ODVSUiFWLFDVFRORQLDOHVGHODVHOHFFLyQUDFLDOODHVWHULOL]DFLyQ forzosa y la dominación hasta la muerte a través del trabajo, se suman durante el período neo-colonial el control a través de la privación de los bienes mínimos necesarios para la vida, la privatización de la tierra, el solapamiento de las funciones políticas y policiales, la militarización de la relación social, la negación del derecho a la integridad corporal y sexual… Esta es la pregunta a la que se enfrenta el Grupo Chaclacayo en los años 80: ¿Qué lugar puede ocupar el arte cuando el terror se convierte en el componente principal de la relación política? 1LQJXQR2TXL]iVVt4XL]iVVHDSRVLEOHKDFHUGHODUWHXQODERUDWRULRSHUIRUPDWLYRHQHOTXHFRPR en un ejercicio de alquimia poética y política, las técnicas de la muerte puedan ser transformadas en técnicas de resistencia y supervivencia. Pero ¿cómo, con qué medios? Entre la urgencia desesperada y la utopía, el Grupo Chaclacayo trabaja con la materialidad cutre GHODVSROtWLFDVGHODFUXHOGDG\FRQODWHDWUDOL]DFLyQLFRQRFODVWDGHORVVtPERORVWHRFUiWLFRVTXH históricamente han venido a legitimarlas. En condiciones de precariedad vital y de terror, oponen el arte \ODSHUIRUPDQFH FRPRWpFQLFDVGHLQYHQFLyQGHIRUPDVGHPRGRVGHPLUDUGHVLJQLÀFDFLyQVRFLDO\ GHSURGXFFLyQGHVXEMHWLYLGDG DODQHFURSROtWLFD\OOHYDQDFDERXQDUHVLJQLÀFDFLyQSHUIRUPDWLYDGHODV técnicas de la violencia. /DREUDGHO*UXSR&KDFODFD\RWRPDSULPHURODIRUPDGHXQGLDJUDPDRUJiQLFRGHOD necropolítica, un esquema sensible e inteligible dibujado sobre la tierra, escrito con y sobre el cuerpo, VREUHODSLHOFRQORVÁXLGRVPLVPRVTXHHOFXHUSRVREHUDQRGRPLQD\FRQÀVFDFRQVDQJUHVHPHQ con mierda. Ese diagrama funciona al mismo tiempo como una representación que permite ver cómo funcionan las estructuras soberanas para convertirse después en proyecto de transformación social (imagen viva, proyección, movimiento) capaz de inducir desplazamientos críticos (desde las técnicas GHWRUWXUDKDVWDODVWpFQLFDVGHODPRU HQODVIRUPDVGHSRGHU\GHUHSURGXFFLyQGHODYLGD>ÀJ@ Al derecho a matar de la necropolítica oponen los artistas del Grupo Chaclacayo el derecho a amar. A los rituales patriarco-coloniales de la muerte los artistas oponen los rituales inventados GHOWUDYHVWLVPR\GHODSURGXFFLyQGHSODFHUFRQWUDVH[XDO$ODÀFFLyQGHO¶HQHPLJR·\GHO¶WUDLGRU· FRPRÀJXUDVGHORSROtWLFRRSRQHQODÀJXUDGHODPDQWHLPSXUR$ODJHVWLyQGLVFLSOLQDULDGHODVDQJUH GHOVHPHQ\GHODPLHUGDRSRQHQXQDHFRQRPtDGHVMHUDUTXL]DGDGHÁXLGRV\yUJDQRVGHPDWHULDV RUJiQLFDVHLQRUJiQLFDV)UHQWHDOLPDJLQDULRVREHUDQRGHOVROGDGRYLULODSDUHFHODLPDJHQGHO-HVXFULVWRPDULFDODYXOQHUDELOLGDGGHODORFD'HWUiVGHODREVHVLyQDXWRÁDJHODQWHGH6DQWD5RVDGH/LPD emerge la potencia de las técnicas del cuerpo (el manejo del placer y del dolor) para generar subjetividad disidente. Al régimen de guerra total, el Grupo Chaclacayo opone nuevas y singulares formas de hacer el amor(VWDHVHQGHÀQLWLYDVXDSXHVWDDUWtVWLFDHVSUHFLVRDPDUDOFXHUSRTXHHOSRGHUGHVLJQDFRPR cuerpo para la muerte. Es preciso atreverse a hacer el amor con el cuerpo de la necropolítica. Último exorcismo colectivo, última transgresión necrofílica como metodología de reinvención del sujeto político >ÀJÀJ@ (VHVWHWUDEDMRGHUHFRGLÀFDFLyQ\UHVLJQLÀFDFLyQGHODVWpFQLFDVGHPXHUWHHOTXHSHUPLte explicar los innumerables motivos sadeanos (no sadomasoquistas5 TXHFRQVWLWX\HQODVÀFFLRQHV construidas por el Grupo Chaclacayo (y en particular la obra de Sergio Zevallos): cuerpos atados, susSHQVLRQHVLQYHUVLRQHVGHODERFD\GHODQRGHOURVWUR\GHODVQDOJDVFUXFLÀ[LRQHVXVRV¶LPSURSLRV· de signos y símbolos religiosos, formación de nuevas corporalidades a partir del ensamblaje de miembros y órganos dispares, inversiones de las posiciones históricas de lo masculino y de lo femenino, GHORKXPDQR\GHORDQLPDO«>ÀJ@ Como en las diferentes fotografías de la serie Suburbios (1983) de Zevallos, en las que GRVFXHUSRVRFXSDQORTXHSDUHFHVHUXQDDUTXLWHFWXUDHQUXLQDV HFOHVLiVWLFDUHSUHVHQWDFLyQGHO SRGHUHVWDWDOFiPDUDVGHWRUWXUDRGHPDVWXUEDFLyQ HQWUHJiQGRVHDXQDVHULHGHDFFLRQHVTXHYDQ desde la mímica vertical y beata de la pose de los santos, hasta la dislocación total y horizontal de los cuerpos caídos, pasando por una combinatoria febril de posiciones y de agenciamientos múltiples de yUJDQRVPLHPEURV\RULÀFLRVTXHDXQTXHH[SOtFLWDPHQWHVH[XDOHVQRVHGHMDQUHSUHVHQWDUGHDFXHUGR FRQODHFRQRPtDGHODPXHUWHQLWDPSRFRFRQODUHSURGXFWLYD>ÀJ@ Sería un error epistemológico pensar esta resonancia del Marqués de Sade en el Grupo &KDFODFD\RGHVGHSDUiPHWURVSVLFRSDWROyJLFRVRGHH[FHQWULFLGDGVH[XDO$OFRQWUDULRODFRQH[LyQ entre ambos deriva del hecho que tanto uno como otros, situados en dos bordes de la historia (Sade al borde las rebeliones anti-soberanas de Haití y de la revolución francesa y el Grupo Chaclacayo al ERUGHGHODUHRUJDQL]DFLyQQHROLEHUDOGHODVIRUPDVGHJRELHUQRSDWULDUFDO\FRORQLDOHQ3HU~ UHÁH[LRnan y trabajan con las técnicas del poder de dar la muerte que caracterizan a las sociedades en las que viven. Sade es no sólo uno de los mejores analistas de las técnicas necropolíticas que dominan el $QWLJXR5pJLPHQ PpWRGRVGHWRUWXUDGHUHVWULFFLyQGHOFXHUSR\HVFHQLÀFDFLyQS~EOLFDGHODPXHUWH  6 Sobre Ocaña ver Beatriz Preciado, “La Ocaña que merecemos. Campceptualismo, subalternidad y políticas performativas,” en Ocaña: 1973–1983: acciones, actuaciones, activismo (Barcelona: Institut de Cultura de l’Ajuntament de Barcelona, 2011), pp. 71-168. 56 57 sino también el primero en detectar el traspaso de energía libidinal que acompaña a los procesos necropolíticos. El poder soberano no sólo da la muerte sino que extrae placer de los procesos de teatralización de la violencia. Herederos críticos de Sade, el Grupo Chaclacayo pertenece, como Artaud, +DQV%HOOPHU'XFKDPS/RXLVH%RXUJHRLV&DUROHH6FKQHHPDQQRLQFOXVR%UXQR*LURQFROLDXQD SUiFWLFDSRpWLFDHQODTXHHODUWLVWDFRQVWUX\HXQODERUDWRULRSOiVWLFRGHVGHGRQGHLQYHQWDUIRUPDV anatómico-político disidentes. Pero si a Sade (y a los surrealistas) le costaba renunciar a su propia posición soberana (en cuanto hombre blanco, aristócrata, padre), los miembros del Grupo Chaclacayo aparecen como ÀJXUDVVXEDOWHUQDV WDQWRUDFLDOFRPRVH[XDOPHQWH GHODUHSUHVHQWDFLyQSDWULDUFDO\FRORQLDO(V desde esa posición minoritaria desde donde van a interceptar e interrumpir las representaciones dominantes del imaginario necropolítico del Perú –que atraviesan tanto las modalidades imperiales y coloniales de poder, como sus trasuntos neoliberales o sus formaciones antagonistas y militarizadas de izquierda. Es también esa capacidad para entender el cuerpo como material vivo sobre el que el poder heteropatriarcal y colonial despliega y teatraliza sus técnicas de muerte, como un conjunto de ÁXLGRV\yUJDQRVTXHHOSRGHURUJDQL]D\GLVWULEX\HODTXHH[SOLFDODSUR[LPLGDGGHODREUDGHO*UXSR Chaclacayo con los trabajos feministas y contra-sexuales de la misma época. Pensamos aquí en la SUR[LPLGDGFRQORVULWXDOHV\VDFULÀFLRVIHPLQLVWDVGHORVDxRVFRPRSRUHMHPSORODLQVWDODFLyQ 6DFULÀFH (1971) en la que Faith Wilding expone un cuerpo de mujer cubierto de tripas de vaca y postrado frente a una pared, en la que catorce compresas manchadas de sangre de menstruación GLEXMDQXQHVFHQDULRGHUD\DVURMDVVREUHHOTXHVHDSR\DXQFUXFLÀMR>ÀJ@ Así mismo, la serie de dibujos Sangre y Ceniza. Variaciones sobre la bandera (1987) de 6HUJLR=HYDOORVUHFXHUGD VLQRHQODUHVROXFLyQIRUPDOVtHQVXFDSDFLGDGGHVPLWLÀFDGRUD\VXEYHUVLva) a The Flag is Bleeding (1967) de Faith Ringgold. Zevallos transforma las dos bandas rojas de la EDQGHUDGHO3HU~HQGRVPDWHULDVRUJiQLFDVTXHVHSHQHWUDQVHFDQLEDOL]DQVHPH]FODQ\VHGHVWUX\HQ /DEDQGHUD\DQRHVDTXtVLPSOHPHQWHXQVtPEROR LQRUJiQLFRHVWiWLFR GHODQDFLyQVLQRHODOJRULWPR de un proceso material y visual (hecho de violencia y sexo) a través del que se construye la comunidad QDFLRQDO'HOPLVPRPRGRODVVXFHVLYDVPHWDPRUIRVLVFRUSRUDOHVDODVTXHGDOXJDUODUHSUHVHQWDFLyQ política de la bandera –la transición desde el automatismo surrealista y la gestualidad performativa hasta la deconstrucción de la pintura como encarnación mítica del arte– no dejan de hacer pensar en la resistencia del cuerpo a la violencia que sugieren las acuarelas de los años 60 de la artista Nancy Spero (Victims, Bleeding Bomb, Atom Bomb, Bomb Shiting >ÀJ@ 'HPDQHUDWRGDYtDPiVGLUHFWDORVULWXDOHVPDULFDPLOLWDUUHOLJLRVRVSRGUtDQDQDOL]DUVH en continuidad con las procesiones de travestis y muñecos de papel maché que Ocaña, Nazario y Camilo organizaban en las calles de Barcelona en los últimos años de la dictadura militar franquista >ÀJ@6FRQORVULWXDOHVS~EOLFRVGH/DV<HJXDVGHO$SRFDOtSVLVHQ&KLOHDOÀQDOGHODGLFWDGXUD militar, pero también con los ritos sociales que producían las artistas norteamericanas Suzanne Lacy y Leslie Labowitz en In Mourning and in Rage (1977) para protestar contra la violación y el asesinato impune de mujeres en las calles de Los Ángeles. Aunque parece obvia la relación de la obra de Zevallos con una tradición de experimentación performativa y visual de producción de identidad de género y sexual, las diferencias son notables. Aquí la performatividad no se reduce a la producción de una representación paródica de género. Las variaciones travestis de Zevallos podrían ponerse en conexión con la multiplicación de mascaradas y GLVWRUVLRQHVGHJpQHURHQODIRWRJUDItDTXHFRPLHQ]DHQORVDxRVYHLQWHFRQ'XFKDPS\&ODXGH&DKXQ pasando por las fotosecuencias de la Self Performance  GH-UJHQ.ODXNH>ÀJ@RSRU los autoretratos de Pierre Molinier o de Michel Journiac. Sin embargo, la radicalidad teatral de Zevallos VREUHSDVDORVMXHJRVGHPiVFDUDVODYLROHQFLDGHODVWpFQLFDVQHFURSROtWLFDV\VXLPSDFWRVREUHOD estabilidad de la mirada impiden representar el cuerpo de acuerdo con las normas visuales del retrato burgués que aún siguen dominando los códigos de Klauke, o incluso de Molinier, y apuntan a la producción de un sujeto radicalmente desmarcado de las coordenadas de la norma sexual y política que KDFDUDFWHUL]DGRODUHSUHVHQWDFLyQSLFWyULFDIRWRJUiÀFD\SHUIRUPDWLYDHQHOVLJOR;; Beatriz Preciado (Burgos, 1970) (VÀOyVRIRD\DFWLYLVWDTXHHU(VGRFWRUDHQ)LORVRItD\7HRUtDGHOD$UTXLWHFtura por la Universidad de Princeton. Su trabajo como curador/a privilegia la organización de proyectos colaborativos con artistas, activistas y pensadores TXHH[SORUDQODVGLVWLQWDVSUiFWLFDVSHUIRUPDWLYDVIRUPDVGHLQWHUYHQFLyQ\ estrategias discursivas que permiten movilizarse frente a la gestión biopolítica GHOFXHUSRGHOVH[RGHOJpQHUR\GHODUD]DHQHOFDSLWDOLVPRFRQWHPSRUiQHR Entre estos proyectos se encuentran: “Retóricas del género/Políticas de la identidad” (BNV/UNIA, Sevilla, 2003), “Maratón Posporno” (MACBA, Barcelona, 2004), “FeminismoPornoPunk” (Arteleku, San Sebastian, 2008), “La Internacional Cuir” (MNCARS, Madrid, 2011) o “Gender Lab” (Emmetrop, Bourges, 2012). Entre sus publicaciones destaca 0DQLÀHVWR&RQWUD6H[XDO(Opera Prima, 2002), Testo Yonqui: Sexo, drogas y biopolítica en la era farmacopornoJUiÀFD (Espasa Calpe, 2008), y Pornotopía (Anagrama, 2010). Actualmente enseña historia política del cuerpo y estudios de género en la Université Paris VIII. Es director/a del Programa de Estudios Independientes (PEI) del MACBA, GRQGHHVWiFXUDQGRXQDH[SRVLFLyQVREUH&DURO5DPD 58 1 I use the term necropolitics here, although Foucault preferred the Greek root “thanatopolitics.” See Michel Foucault, Discipline and Punish: The Birth of the Prison. Trans. Alan Sheridan (London: Allen Lane, 1977); Society Must Be Defended: Lectures at the Collège de France, 1975-19767UDQV'DYLG Macey (New York: Picador, 2003). 2 Achille Mbembe, “Necropolitics,” in Public Culture   'XUKDP 'XNH8QLYHUVLW\3UHVV S 3 Achille Mbembe, “Necropolitics,” p. 20. Making love to the necropolitical body: the artistic practice of Grupo Chaclacayo at the limits of sovereignty Beatriz Preciado Between 1982 and 1994, Grupo Chaclacayo (Helmut Psotta, Raúl Avellaneda and Sergio Zevallos) produced one of the sharpest artistic-performative critiques of the operation of necropolitics in postcolonial societies and revealed the construction of its machines of mythical-religious semiotic production and its sensory and sexual metabolization of the social body. Through a genealogy of the relations of knowledge/ power in modernity, Foucault describes necropolitics (or thanatopolitics) as the form of governing that characterizes sovereign regimes. This is an ‘art of government’ whose modes of producing and legitimizing truth are theocratic and expressed primarily as the ‘the right to kill’.1 This is the ruthless logic of the sovereign forms of governance: within necropolitics, power is violence, the body (executioner or victim) is the body for death and subjectivity (dominant or subaltern) is constructed through terror. Although Foucault understood that the French revolution and the defeat of the sovereign and monarchic power in the eighteenth century produced new forms of government no longer characterized by the management of death but rather by the maximization of the life of populations (biopolitics), it is becoming increasingly clear today that these biopolitical forms of governance were actually articulated with necropolitical techniques during the processes of colonization in America and throughout the European effort to maximize economic exploitation as well as control processes of sexual and social reproduction. Cameroon-born philosopher Achille Mbembe shifts the analyses of Carl Schmitt and Foucault towards the context of colonization and uses their work to describe the ‘sovereign collective imagination’ of the racist states whose only instrument RIJRYHUQDQFHLVYLROHQFHLWVHOI´WKHFRPSOHWHFRQÁDWLRQ of war and politics...the perception of the existence of the 4 Marcos López in Revuelta(s), a ÀOPE\)UHGL&DVWUR\5HQDWH&RVWD (Fondation Cartier, 2014). 59 5 With ‘sadian’,UHIHUVSHFLÀFDOO\ to the imaginary pertained to the texts and architectural projects of the Marquis de Sade as opposed to the Freudian notion of ‘sadomasoFKLVP·ZKLFKLVLQWHQWRQGHÀQLQJ sexual pathologies. 6 See Beatriz Preciado, “The Ocaña we deserve: campceptualism, subordination and performative policies,” in Ocaña: 1973-1983: acciones, actuaciones, activismo (Barcelona: Institut de Cultura de l’Ajuntament de Barcelona, 2011), pp. 412-438. Other as an attempt on my life, as a mortal threat or absolute danger whose biophysical elimination would strengthen my potential to life and security”.2 For Peruvian society, the eighties –when Grupo Chaclacayo were living, performing and producing– can be seen as a moment of pure articulation of the necropolitical forms of power characterized by the armed FRQÁLFt between the Peruvian State Army and the Maoist organization Sendero Luminoso [Shining Path]. In this context, the techniques of death (torture, betrayal, the social distribution of WKHVXEMHFWLYHÀJXUHVRIWKH¶HQHP\·RUWKH¶WUDLWRU·GLVDSpearances, kidnappings, mutilations, mass graves...) saturated the realm of politics. Here the military agent of the state, as much as the hero of Marxist modernity, is the “subject who is intent on proving his or her sovereignty WKURXJKWKHVWDJLQJRIDÀJKWWRWKHGHDWK”.3 However, the QHFURSROLWLFVRI3HUXLVQRWGHÀQHGE\WKH¶LQGXVWULDOL]DWLRQ of death’ typical of central-European Nazism and the ‘rationalization of terror’ carried out by the ‘civilized’. In the post- or neo-colonial situation the exercise of violence is traversed rather by vectors of the extractionist economy, H[WHUQDOGHEWÀQDQFLDORSSUHVVLRQWKHVRFDOOHGVWDWH of ‘underdevelopment’ and poverty. In the ‘south’ even the WHFKQLTXHVRIYLROHQFHDUHPRGLÀHGE\WKH¶SRHWLFVRI wrongdoing’ as it has been called by Argentine artist Marcos Lopez.4 In the Tropics, necropolitics gets tacky, dirty, cheap, ugly, trashy. To understand the work of Grupo Chaclacayo and how it relates to the operation of sovereign-colonial power, it is necessary to bring together two gender and sexual HOHPHQWVLQVXIÀFLHQWO\H[SORUHGE\)RXFDXOWDQG0EHPEH 7KHÀUVWLVWKDWWKHFKDUDFWHULVWLFIRUPRIVRYHUHLJQFRORQLDO power is not simply monarchic or imperial government but also patriarchal7KHVRYHUHLJQVXEMHFWLVGHÀQHGÀUVWRI all as the male, impenetrable, heterosexual subject. At the same time, blood and semen are understood as sovereign ÁXLGVWKURXJKZKLFKSRZHULVH[SUHVVHGDQGWUDQVPLWWHG This means that the father is the father not because of his power to give life but because of his power to kill. From here, the father, the soldier –but also the revolutionary Marxist hero– need to behave like operators of death (disseminators of blood and semen) to reclaim their sovereignty. The second element equally crucial for the work of the Peruvian collective is that although the modern and VFLHQWLÀFQRWLRQRIrace (which had served to legitimize the slave economy and processes of colonization by seventeenth century) emerges in the context of the biopolitical management of populations, this system of organization was automatically accompanied by a combination of strategies of extermination that began with the management of the so-called races –‘indigenous, blacks, primitives’. The racial SXULÀFDWLRQRIWKHERG\LQWKHFRORQLDOHQFODYHVWKDW characterizes the biopolitical management of the white heterosexual body also needed a whole system of complementary techniques of death that serve to suppress and control the reproduction of non-white and non-heterosexual bodies. The neo-colonial period would add to the colonial practices of racial selection, forced sterilization, and domination of death through labor new forms of control through deprivation of minimum goods necessary for life, land privatization, the overlapping of the function of politics and police, the militarization of social relations and the denial of rights and dignity with respect to the body and sexuality. This is the question that Grupo Chaclacayo confronted in the eighties: what place can art possibly occupy when terror becomes the main form of the political relationship? Nothing. No-place. Or, perhaps something: perhaps it might be possible to make art into a performative laboratory in which, as if in a exercise of poetic and political alchemy, the techniques of death could be transformed into the techniques of resistance and survival. But how? In what medium –with what materials? Somewhere between desperate urgency and utopia, Grupo Chaclacayo worked with the cheap and ugly materiality of the politics of cruelty and the iconoclastic theatricalization of the theocratic symbols that had historically functioned to legitimize terror. In conditions of utter precarity, they used art and performance (understood as technologies of inventing forms, ways of seeing, social meaning and subjectivities) against necropolitics and they FDUULHGRXWWKHSHUIRUPDWLYHUHVLJQLÀFDWLRQRIWKHWHFKniques of violence. The work of Grupo Chaclacayo thus takes the form of an organic diagram of necropolitics –a sensitive and intelligible system drawn on the earth, written with and RQWKHERG\RQWKHVNLQ,WLVGRQHZLWKWKHVDPHÁXLGV WKDWWKHVRYHUHLJQERG\GRPLQDWHVDQGFRQÀVFDWHVEORRG semen, shit. This diagram functions at the same time as a representation that visibilizes the operation of sovereignty’s structures and as a diagramatic project of social transformation (living image, projection, movement) –capable of provoking the critical displacement (from the technologies of torture to the technologies of love) of forms of power and WKHUHSURGXFWLRQRIOLIH>ÀJ@ Against necropolitic’s right to kill, the artists of *UXSR&KDFODFD\RDIÀUPHGWKHULJKWWRORYH$JDLQVWWKH patriarchal-colonial rituals of death, the artists use the ritualism invented by transvestism and the production of FRQWUDVH[XDOSOHDVXUH$JDLQVWWKHÀFWLRQRIWKH¶HQHP\· DQGWKH¶WUDLWRU·DVWUXHSROLWLFDOÀJXUHVWKH\GHSOR\WKH ÀJXUHRIWKHLPSXUHORYHU$JDLQVWWKHGLVFLSOLQDU\PDQDJHment of blood, semen and shit they use a de-hierarchized HFRQRP\RIÁXLGVDQGRUJDQVRIRUJDQLFDQGLQRUJDQLF materials. In the face of the sovereign collective imagination of the masculine soldier they introduce an image of a queer Jesus Christ and present the vulnerability of the sissy. They propose that behind the techniques of the body SURSDJDWHGE\WKHREVHVVLYHVHOIÁDJHOODWLQJ6DLQW5RVH of Lima, lie the techniques of generating dissident subjectivities through reappropriating the use of pleasure and pain. Against the regime of total war, Grupo Chaclacayo invent new and unique forms of making love. This is their GHÀQLWLYHDUWLVWLFSRVLWLRQWRORYHSUHFLVHO\WKDWERG\GHVLJnated by the sovereign power as the body for death. It is necessary to make love to the body of necropolitics. It is the ultimate collective exorcism –the ultimate necrophiliac transgression proposed as a methodology for the reinvenWLRQRIWKHSROLWLFDOVXEMHFW>ÀJÀJ@ It is this work of recodifying and resignifying the techniques of death that helps to explain the sadian5 grounds (although not sadomasochist) that constitute the ÀFWLRQVFRQVWUXFWHGE\*UXSR&KDFODFD\R SDUWLFXODUO\LQ the work of Sergio Zevallos). This is an imaginary constructed from bound bodies, suspended bodies, inversions of the mouth and anus, face and buttocks, FUXFLÀ[LRQV ‘improper’ use of religious signs and symbols, new forms corporality made from assemblages of parts and disparate organs, reversals of historical positions of the masculine DQGIHPLQLQHKXPDQDQGDQLPDO>ÀJ@. In the series Suburbios (1983) [Suburbs] by Zevallos, two bodies occupy what seems to be an architecture in ruins: an ecclesiastical building, an architectural representation of the power of the state, a masturbation or torture chamber. Zevallos and his collaborator are pictured indulging in a series of actions that go from the sanctimonious holier-than-thou poses of the saints to the total and horizontal dislocation of the ‘fallen’ bodies: he presents 61 60 a combination of positions and multiple arrangements of RUJDQVERG\SDUWVRULÀFHV$OWKRXJKWKHVHHOHPHQWVDUH explicitly sexual, they form a system of representation that never ceases to oppose the dominant gender and sexual HFRQRP\RIGHDWKDQGUHSURGXFWLRQ>ÀJ@ It would be an epistemological error to approach this resonance of the Marquis de Sade in Grupo Chaclacayo through the frame of psychopathology or sexual eccentricity. The connection between the two alternatively derives from the fact that both are situated at the borders of history: Sade is between and outside of the antisovereign revolts of Haiti and the French Revolution while Grupo Chaclacayo stand at the edge of the neoliberal reorganization of the forms of patriarchal and colonial governance in Peru. They are both at the border of history UHÁHFWLQJRQDQGZRUNLQJZLWKWKHWHFKQLTXHVRIWKHSRZHU to kill, which characterize the societies they live in. Sade is not only one of the best analysts of the necropolitical techniques that dominated the Ancient Regime (methods of torture, of restriction of the body and public VSHFWDFOHRIGHDWK EXWKHZDVDOVRWKHÀUVWWRGHWHFWWKH transfer of libidinal energy that occurs with necropolitical processes. The sovereign power not only kills but extracts pleasure out of the processes of theatricalizing violence. The critical heirs of Sade –Grupo Chaclacayo, Antonin $UWDXG+DQV%HOOPHU0DUFHO'XFKDPS Louise Bourgeois, Carolee Schneemann or even Bruno Gironcoli– belong to a VSHFLÀF form of poetic practice whereby the artist constructs a laboratory for the invention of dissident political-anatomical forms. While Sade (and the Surrealists) ultimately had trouble giving up their own position of sovereignty (white, aristocratic, patriarchal positions) the members of Grupo &KDFODFD\RHPHUJHDVVXEDOWHUQÀJXUHV UDFLDODVPXFK as sexual) in relation to the patriarchal and colonial regime of representation. It is from this minority position that they intercept and interrupt the dominant representations of the necropolitical collective imagination. In Peru this traverses both the imperial and colonial modalities of power as much as the neoliberal transcripts or the antagonist and militarized political articulations of the left. This ability to understand the body as a livingmaterial inscribed with the heteropatriarchal and colonial power’s techniques of death (which serve to organize and GLVWULEXWHDZKROHFRPELQDWLRQRIÁXLGVDQGRUJDQV LV also what accounts for the connection between the work of Grupo Chaclacayo and the feminist and contra-sexual works of the same period. We might think of the feminist ULWXDOVDQG¶VDFULÀFHV·RIWKHLQVWDOODWLRQ6DFULÀFH (1971) in which Faith Wilding places a woman’s body covered in cow intestines and prostrate in front of a wall covered in fourteen sanitary towels stained by menstruation blood, VNHWFKLQJRXWDVWDJHRIUHGVWULSHVRQZKLFKDFUXFLÀ[ UHVWV>ÀJ@ The series of drawings Sangre y ceniza. Variaciones sobre la bandera [Blood and Ashes. Variations of the Flag] (1987) by Sergio Zevallos recalls (if not in a resolute way, certainly via its ability to demystify and subvert) A Flag is Bleeding (1967) by Faith Ringgold. Zevallos transforms WKHWZRUHGVWULSHVRIWKH3HUXYLDQÁDJLQWRWZRRUJDQLF materials that are penetrated, cannibalized, mixed and GHVWUR\HG7KHÁDJLVQRORQJHUVLPSO\DV\PERO LQRUJDQLF static) of the nation, but an algorithm of a material and visual process (made from violence and sex) that constructs national community. In the same way, the successive metamorphoses of the body in the political UHSUHVHQWDWLRQRIWKHÁDJUHFDOO1DQF\6SHUR·VZDWHUFRORU representations of the body’s resistance to violence in the 1960s (Victims, Bleeding Bomb, Atom Bomb, Bomb Shitting >ÀJ@ These fag-military-religious rituals can be analyzed as a direct continuation of the queer processions of Ocaña, Nazario and Camilo organized in the streets of Barcelona GXULQJWKHÀQDO\HDUVRIWKH)UDQFRPLOLWDU\GLFWDWRUVKLS >ÀJ@6 with the public performance of Las Yeguas del Apocalypsis in Chile at the end of military dictatorship, or the social rituals organized by North American artists Suzanne Lacy and Leslie Labowitz, such as In Mourning and in Rage (1977), which protested against the unpunished murders and violence against women in the streets of Los Angeles. While there is a clear relation between the work of Zevallos and an expanded tradition of performative experimentation and visual production of identity, gender and sex, the difference must also be accounted for. Here the performative cannot be reduced to the production of a parodied representation of gender. If that were the case, the transvestite forms of Zevallos might be related to the multiple disruptions and manipulations of gender that EHJLQWREHSURGXFHGLQWKHVE\'XFKDPSRU&ODXGH Cahun, Jürgen Klauke’s Self-Performance (1972-1973) >ÀJ@RUWKHVHOISRUWUDLWVRI3LHUUH0ROLQLHURU0LFKHO Journiac. However, the theatrical radicalism of Zevallos surpasses these games of the mask: interacting with the violence of necropolitical techniques and their impact on the stability of the normative gaze is what prevents a representation of the body that is in accordance with the visual norms of the bourgeoisie portrait. Where these visual norms persist in the representative codes of Klauke, or even Molinier, Sergio Zevallos points rather to the production of a subject radically distanced from the coordinates of the sexual and political norms that characterize the pictorial, photographic and performative representation of the twentieth century. Beatriz Preciado (Burgos, 1970) 6KHLVDSKLORVRSKHUDQGTXHHUDFWLYLVW6KHKROGVD3K'LQ Philosophy and Theory of Architecture from Princeton University. As a curator, hirs work favors the encounter of artists, activists and thinkers with the aim to develop and explore new performative practices, forms of intervention, and discursive strategies against t he biopolitical management of the body, sex, gender, and race within contemporary capitalism. Some of these projects are: Rethorics of Gender/Politics of Identity, BNV/UNIA, Seville (2003), Postporn Marathon, MACBA, Barcelona (2004), PostPornFeminism, Arteleku, San Sebastian (2008), Cuir International MNCARS, Madrid (2011), Gender Lab, Emmetrop, Bourges (2012). Among hirs recent books are Manifeste contra-sexuel, Balland, Paris (2000), Testo Junkie: Sex, Drugs and Biopolitics in the Pharmacopornographic Era, The Feminist Press, New York (2013), and Pornotopia, 2010 (forthcoming in English by Zone Books). S/he currently teaches philosophy of the body and gender studies at the Université Paris VIII. S/he is the director of the Independent Studies Program (PEI) at the MACBA where she is curating a forthcoming exhibition by Carol Rama. 62 63 Guerra, intimidad y deseo disidente. Conversación sobre el Grupo Chaclacayo, antes y después Jaime Higa, Miguel A. López, Frido Martin, Alfredo Márquez, Sergio Zevallos Lima, 5 de noviembre de 2013 War, intimacy, and dissident desire. Conversation about Grupo Chaclacayo, before and after 64 65 Fig. 44 Jaime Higa y Eduardo Tokeshi, Uchuraccay, 1985. Colección Micromuseo (“al fondo hay sitio”). Fig. 41 Casa Taller en Chaclacayo, Lima, ca. 1985-1987. Fotografía: Raúl Avellaneda. Archivo Sergio Zevallos. Fig. 42 Grupo Chaclacayo en su casa taller. Atrás, de izquierda a derecha: Sergio Zevallos, Helmut Psotta y Raúl Avellaneda. Fotografía: César Guerra. Fig. 45 Integrantes del colectivo Los Bestias en la exposición Perú… un sueño del Grupo Chaclacayo en el Museo de Arte de Lima, 1984. Fotografía: Raúl Avellaneda. Archivo Sergio Zevallos. Fig. 43 Acción de Helmut Psotta con trabajos de sus alumnos, Universidad Católica del Perú, Lima, 1982. Fotografía: César Guerra. Publicada en el artículo “Todo y/o Nada,” en Lima Kurier, Lima, n. 25 (25 de julio de 1982), p. 3. Cortesía GoetheInstitut Lima. Fig. 46 Los Bestias. Deshechos en Arquitectura, 1984. Fotografía: Alex Ángeles. Archivo Los Bestias. 66 67 Fig. 50 Portada del diario La República, Lima, 25 de agosto de 1984. Fig. 49 Narcosis, Primera Dosis. Primera maqueta del grupo, 1985. Carátula diseñada por Jaime Higa. Archivo Luis Alvarado. Fig. 47 Herbert Rodríguez, Cadáveres, ca. 1986. Collage y fotocopia. Cortesía del autor. Fig. 48 E.P.S. Huayco, Cojudos, 1980. Serigrafía sobre papel. 65 x 50 cm. Museo de Arte de Lima. Donación Jorge Gruenberg y Armando Williams. Fig. 51 Taller NN, PERÚ 1984-1989, cartel del concierto organizado por la banda Kaos y NN, Lima, 1989. Archivo Alfredo Márquez. 68 69 Fig. 56 Jaime Higa. Sin Título, ca. 1988-1990. Sin medidas disponibles. Archivo Jaime Higa. Fig. 52. Teatro del Sol, puesta en escena de El HomoVH[XDORODGLÀFXOWDGGHH[SUHVDUVHTeatro Cocolido, Lima, 1990. Archivo Germain Machuca. Fig. 53 Enrique Polanco, Al cerdo peruano del 83, anuncio del recital y concierto de Kloaka, Del Pueblo y Kolarock, Lima, 1983. Fig. 55 Helmut Psotta (Grupo Chaclacayo), Miserére mei, Deus, ca. 1986-1987. Tomado de Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin, Alexander Verlag, 1989). Fig. 54 La Procesión, Lima, 1982. Participan: Fernando Bryce, Frido Martin, Sergio Zevallos, Raúl Avellaneda y Helmut Psotta. Fotografía: César Guerra. Archivo Sergio Zevallos. Fig. 57 Taller NN, Viva el maoísmo, 1989. Serigrafía sobre papel. 76 x 56 cm. Producido en el II Encuentro Internacional de Serígrafos. Edición Taller René Portocarrero, La Habana, Cuba. Archivo Alfredo Márquez. 70 71 1. El texto inédito de Hugo Salazar del Alcázar se titula “Chuang-Tse, Freud y el sueño peruano” y se publica por vez primera en este volumen (véase página 116). Su otro texto es “Veleidad y demografía en el no-objetualismo peruano,” Hueso Húmero, Lima, n.  MXOLRVHWLHPEUH>@  pp. 112-121. (Todas las notas son del editor). 3. Sobre ello véase también Miguel A. López, “Ornamentos. Flores. 7UiÀFRVHVSXULRV-DLPH+LJD Historia invertida,” en 2UQDPHQWR -DLPH+LJD$QWRORJtDPtQLPD (1997-2013). Catálogo de de exposión (Lima: Centro Cultural Ccori Wasi de la Universidad Ricardo Palma, 2013). 2. Véase Emilio Tarazona, “Soñando sin dormir, al ojo abierto. Una (abreviada) conversación con Helmut J. Psotta,” ,OODSD5HYLVWDGHO,QVWLWXWR de Inves-tigaciones Museológicas y Artísticas de la Universidad Ricardo Palma, Lima, n. 6 (2009), pp. 85-92. Los inicios Alfredo Sergio, ¿qué es para ti el Grupo Chaclacayo? Sergio Mi idea sobre eso ha ido cambiando. Lo primero sería contar cómo surge el nombre. En la uni- versidad nos encontramos tres personas: Helmut Psotta quien vino de profesor invitado a la Escuela GH$UWHGHOD3RQWLÀFLD8QLYHUVLGDG&DWyOLFDGHO3HU~\5D~O$YHOODQHGD\\RTXHpUDPRVHVWXGLDQWHV Los tres teníamos intereses comunes en lo creativo, personal y afectivo. No nos unía solamente el arte, había empatía política. En 1982, luego de que los tres dejamos la universidad nos mudamos a una casa en el distrito de Chaclacayo donde trabajamos por casi siete años, hasta enero de 1989 FXDQGRQRVIXLPRVD$OHPDQLD>ÀJ@3HURHQUHDOLGDGQRVRWURVQRWHQtDPRVFRQFLHQFLDGHVHUJUXSR En el transcurso del primer año recibimos visitas de distintas personas, y uno de ellos fue el escritor y crítico de teatro Hugo Salazar del Alcázar. Él escribió dos artículos donde habla sobre nosotros, uno quedó inédito y otro fue publicado en la revista Hueso Húmero.1 Él nos llama ‘el grupo de Chaclacayo’. Eso ocurrió pocos meses antes de la inauguración de nuestra única exposición en Lima (Museo de Arte GH/LPDQRYLHPEUHGH \HQHVHPRPHQWRVHVWiEDPRVSODQLÀFDQGRHODSDUDWRGHSUHVHQWDFLyQ del proyecto así que asumimos el nombre ‘Grupo Chaclacayo’, pero no sin discrepancias. Helmut asumió inmediatamente ese nombre, Raúl también lo tomó, y a mí me molestó y reclamé pero me di cuenta que el diálogo no funcionaba porque Grupo Chaclacayo para Helmut era un nombre exótico que no tenía ninguna connotación, pero para mí sí tenía una: de estatus social. Chaclacayo fue entonces, y sigue siendo hoy en ciertos sectores, un barrio exclusivo. Yo sentía esa contradicción pero ellos no OROH\HURQDVt\ÀQDOPHQWHTXHGy /RVHJXQGRVHUtDGHFLUTXHOXHJRGHOÀQDOGHOJUXSRHQFDGDXQRFRQVWUX\yXQD OHFWXUDGLVWLQWDGHORTXHHV\VLJQLÀFDHOJUXSR&ODUDPHQWHKD\GLIHUHQFLDVHQHVDLQWHUSUHWDFLyQ(Q el caso de Helmut considero que él observa el proyecto desde una perspectiva individual y particular, como si el proyecto le fuera propio –eso lo dice en la entrevista que le hizo Emilio Tarazona en 2009.2 Yo no recuerdo que en la época en la que estábamos trabajando y produciendo juntos hubiera esta relación vertical. Había una diferencia porque Helmut tenía más experiencia y era mayor, pero en cuanto al concepto y las ideas producidas la situación era bastante horizontal. Leo en sus expresiones posteriores que él comienza a hablar del Grupo Chaclacayo como un producto personal, lo cual está fuera de la reaOLGDG(QPLVUHÁH[LRQHVSRVWHULRUHV\RKHOOHJDGRDLPDJLQDUORGHVGHXQDÀJXUDLQYHUVDDQWHVTXHXQ grupo delimitado lo veo más como un micro-movimiento. No un movimiento grande como ocurre a veces en las sociedades, sino un micro-movimiento en el sentido de que si bien había un núcleo de tres personas que manteníamos el asunto con nuestro tiempo entregado totalmente, también existían otras personas que participaban continuamente en acciones y proyectos. Es decir, no creo que el Grupo Chaclacayo tenga fronteras precisas sino es más bien una zona de tránsito. Aquí en Lima hubo tres personas muy activas, entre ellas Frido Martin, Sixto Paniora y Jorge Ángeles, cada uno muy distinto y cuya personalidad y carácter aportaban al trabajo. Sixto era originario de Abancay, con una corporalidad grande de serrano macizo. Ángeles en cambio era hijo de una mujer de la Selva y creo que nunca llegó a conocer a su padre, pero por su apariencia uno podría decir que fue un turista extranjero. También hubo un artista alemán, Klaus Wittkamp, quien nos visitó dos veces en Lima y participó luego activamente en las performances en Alemania. El carácter de cada uno de ellos llegó a modelar las obras, al SXQWRGHTXHVLXQRQRSRGtDYHQLUHOWUDEDMRGHÀQLWLYDPHQWHQRLEDDVHUHOPLVPR0XFKDVDFFLRQHV y obras se pensaron y formularon a partir de las condiciones y características de estas personas y así también de las nuestras. Yo veo al Grupo Chaclacayo como esa suma de todas las personas que fueron DÀOLiQGRVHDVtKD\DQVLGRSUR[LPLGDGHVHVSRUiGLFDV/DGHQVLGDG\IXHU]DGHWRGRORTXHVHKL]RIXH el resultado de esa colisión, de esta interacción colectiva. Jaime Quisiera comentar algo vinculado al trabajo en esa primera etapa en la universidad, particular- mente sobre los ejercicios que hacía Helmut que yo llamo ‘automatismo psíquico’, es decir ejercicios GRQGHDWUDYpVGHODDFXPXODFLyQ\ODVHULDOLGDGJUiÀFDVHORJUDEDH[WUDHULPiJHQHVGHOLQFRQVFLHQWH3 Yo veía allí ecos del surrealismo, donde a través del manchado y acumulación era posible encontrar nuevas representaciones. Creo que ese método fue importante para el proceso de exploración íntima que luego ustedes desarrollan como grupo. Recuerdo los primeros trabajos de Raúl y de Sergio y son diferentes a las obras más revulsivas que realizan en la casa en Chaclacayo. Sergio Hay dos asuntos allí y voy a responderlos de forma diferenciada. Primero, lo del método: Helmut tenía varios métodos de trabajo porque venía de una experiencia pedagógica larga en Holanda y Alemania, e incluso en la Universidad Católica de Chile a mediados de los años 60. Él desarrolla ejerFLFLRVTXHYDDÀQDQGRDORODUJRGHORVDxRV/DWUDQVPLVLyQGHHVWHPpWRGRIXHLPSRUWDQWtVLPD3HUR \RQRORGHÀQLUtDFRPRXQGHULYDGRGHOVXUUHDOLVPR<RYHRHVWDVH[SHULHQFLDVHQHOWLHPSRGHXQDIRUPD no programática, es decir, si bien puede tener una raíz en el surrealismo luego éstos se fueron mezclando HLQÁXHQFLDQGRFRQRWUDVFRVDVKDVWDTXHOOHJDQGRQGH+HOPXWTXLHQORVWUDEDMDDVXSURSLDPDQHUD Eso lo conecto con el segundo asunto: el trabajo que hacemos se basa en un encuentro de sujetos con DÀQLGDGHVHYLGHQWHVORTXHVLJQLÀFDEDTXHHVWDEDPX\FODURTXH5D~O\\RHVWiEDPRVGLVSXHVWRVD trabajar ciertos asuntos de forma frontal. Colocar el tema de la sexualidad en el primer plano era lo más LQWHQVRTXHQRVXQtD(QWRQFHVDODKRUDTXH+HOPXWWUDEDMDFRQQRVRWURV\QRVLQÁXHQFLDFRQFLHUWRV PpWRGRVHVRRFXUUHGHQWURGHXQPDUFRGHFRQÀDQ]DLQWHUHVHV\ULHVJRVFRPSDUWLGRV<RQRGLUtD que fue el juego de asociaciones libres lo que nos abrió a la ‘exploración íntima’ sino, por el contrario, nosotros ya sabíamos en qué pozo queríamos meternos y estábamos trabajando en ello. ProbablePHQWHHVRVMXHJRVKLFLHURQTXHVDOWHQPiVFKLVSDVSHURGHÀQLWLYDPHQWH\DHVWiEDPRVDGHQWUR1RVH qué trabajos conociste pero yo no tomaría en cuenta lo producido dentro de la academia. Yo tengo una pequeña colección de cosas que hice con Raúl antes de conocer a Helmut, donde ya hay imágenes de WUDYHVWLVPR\UHJLVWURGHOFXHUSR6LELHQODVH[XDOLGDGHVWDEDDÁRUGHSLHOHQDPERVORTXHQRWHQtDPRV 72 73 4. Véase Gustavo Buntinx, “Seducción y travestismo. Una conversación con Jaime Higa,” en 7H[WR7H[WXUD-DLPH+LJD. Catálogo de exposición (Lima: Museo de Arte Italiano, 1990). posición conservadora en relación a las prácticas experimentales más allá de las disciplinas artísticas tradicionales. 5. Fernando de Szyszlo (Lima, 1925) IXHXQDÀJXUDFHQWUDOHQHODYDQFH del arte abstracto en América Latina a mitad de los años 50. Sus pinturas vinculan culturas ancestrales a los lenguajes artísticos modernistas. Szyszlo estudió en la Escuela de Artes Plásticas de la Universidad Católica del Perú, donde enseñó por varios años. Él es una importante ÀJXUDS~EOLFDHQ3HU~'HVGHORV años 60 Szyszlo mantuvo una D~QHUDQVXÀFLHQWHVKHUUDPLHQWDVSDUDIRUPDOL]DUYLVXDOPHQWHHVRVWHPDVGHXQDPDQHUDFRQWXQGHQte, y eso ocurrió a partir del encuentro. Diría también que el lenguaje anterior de Helmut era particularmente críptico, lo cual cambió como resultado de ese triple choque. Alfredo 0HLQWHUHVDHVWRGHOÁXMROLEUHGHODVLGHDV3LHQVRHQHVWDFRQH[LyQHQWUH+HOPXW5D~O\W~ que produce esta ‘situación’ Chaclacayo, la cual es compleja porque quiérase o no hay un nivel de subordinación: ustedes son alumnos de un profesor, están bajo una institución que es la Universidad Católica, pertenecen al programa que fue construido bajo el paradigma romántico del austríaco Adolfo Winternitz quien creó la Escuela de Arte. Entonces me pregunto ¿qué hizo que se produzca esa situación? Lo que ustedes hicieron fue excepcional, hicieron saltar muchas contradicciones de una forma imponente y sobrecogedora, sin tener nada que ver con lo que vino antes ni con lo que vendría después. Sergio ¿Qué es lo que produjo todo esto? En una sola palabra: intimidad. Cuando tú creas una relación de intimidad con alguien generas otro espacio, otra dimensión de lo que es posible. Mientras no creas esa relación de intimidad no se genera el espacio, y la dimensión de lo posible queda circunscrita a los parámetros que le das. Nosotros generamos mucha intimidad, sobre todo al comienzo. Al conocernos, aún estando en la universidad, Helmut tuvo una relación sexual tanto conmigo como con Raúl, había una transmisión de experiencia y de estar juntos de una manera distinta a la que él puede haber tenido con otras personas en esos años. Si tú tienes una relación como profesor-alumno lo que tienes es un vínculo construido en el aula, si desarrollan una amistad tu rango de transferencia es distinto, y así en los diversos grados y formas en que un cuerpo entabla relación con otro cuerpo. Y no solo para nosotros sino también para Helmut la historia estaba cambiando radicalmente: de pronto se vio emocionalmente involucrado con dos personas en el culo del mundo visto desde Europa. Eso implicó cambiar sus planes de vida, ¡nos quedamos siete años en Lima en eso! De pronto esta ciudad periférica se volvió su nuevo centro y su lugar de origen era ya el culo del mundo. Se invirtió la cosa, de H[WUHPRDH[WUHPR>ÀJ@ un mínimo de alumnos, 60 ó 70, lo que implicó un cambio en términos de dinámica. Quizá cuando el JUXSRHUDPiVSHTXHxRODVUHODFLRQHVGHLQWLPLGDGHUDQPiVVHQFLOODV>ÀJ@ Miguel¢<FXiOHVODUHODFLyQ-DLPH>+LJD@TXHW~HQWDEODVWHFRQ+HOPXW"(QXQDHQWUHYLVWDGH época tú dijiste que ese encuentro fue el momento más importante para ti en la universidad, y otros artistas como Fernando Bryce han señalado que si algún recuerdo importante tienen de su paso por la universidad fue precisamente el encuentro con Helmut.4 Jaime Mi primer contacto con Helmut fue cuando yo estaba haciendo una serie de cuadros con manchas negras y bistro blanco. Yo en esa época paraba drogado en el salón porque para mí era horrible pintar con gente alrededor. No se si había fumado ese día pero sí recuerdo que Helmut entró al salón, vio la obra que estaba haciendo y dijo en tono de sorpresa y reproche: “¿Qué estás haciendo acá?” (risas). Yo me quedé pensando. Él caminaba por la clase, miraba y se quejaba, todo le parecía insulso. Como alumno sus métodos me parecían alucinantes. A muchos compañeros no les gustaba porque se sentían cuestionados, expuestos, salían cosas que ellos no querían dejar ver. Para otros sus métodos era absurdos, decían: “¡Qué es esta huevada!” (risas). Pero la cosa se terminó abruptamente por los problemas que empezó a tener con Winternitz, quien estaba en desacuerdo con que Helmut abordara en clase el tema de la tortura. Sergio Exactamente. Recuerdo que le pidieron dar un curso corto a la clase de tercer año de escultura. Él aceptó, llegó a la clase y dijo: “Vamos a hacer un seminario. Tema: la tortura”. Fue directo. Nosotros previamente ya habíamos conversado sobre cómo la universidad, y en particular la escuela GHDUWHHUDXQDWRUUHGHPDUÀOGRQGHVHREYLDEDORTXHHVWDEDRFXUULHQGRDIXHUD(YLGHQWHPHQWH a muchos no les gustó el asunto. Helmut nos contó que cuando Winternitz se enteró del tema hubo peleas entre ellos, hasta que en un momento él lo encontró en el campus y le increpó acalorado “¿Por qué la tortura? ¿Aquí hay tortura? ¿Acaso has visto alguna vez un torturado caminando por la calle?”. Esa fue la expresión de Winternitz. Jaime Helmut tenía relaciones contigo y con Raúl, ¿pero tú nunca tuviste relaciones con Raúl? Jaime Al mismo tiempo empezaron a correr una serie de rumores, decían que antes de venir a Lima Sergio Sí, antes de eso. Nosotros ya habíamos tenido una relación. Lo que sucede es que Helmut llega a la universidad y pasaba mucho más tiempo con los de primer año, su contrato de trabajo se dirigía a eso, hasta que le empezaron a cargar más cursos, y con mi año solo llevó un curso corto. Helmut me conoce a mi y a Raúl luego de haber conocido a mucha otra gente pero fue con nosotros que el sentido de intimidad se desarrolla intensamente. En el caso de Raúl y yo pues nuestro encuentro fue apenas yo ingresé. En la universidad había siempre una circulación de relaciones afectivas, un ‘todos contra todos’, y existían generaciones más avezadas y otras más tranquilas. Yo fui la primera generación para la cual se hace un programa académico, por lo cual se empezó a exigir que hubiera él había tenido problemas con la universidad donde había enseñado en Chile. “Este profesor viene a convulsionar” decían algunos. Y luego Helmut se alejó de la universidad, y Sergio y Raúl también. /DVLJXLHQWHYH]TXHORVYLIXHFXDQGRH[SXVLHURQHQHO0XVHRGH$UWHGRVDxRVGHVSXpVDÀQHVGH 1984. Realmente creo que la universidad cambió cuando Helmut estuvo allí, fue un remezón. Sin HVDDSHUWXUDPXFKRVKXELHUDQWHUPLQDGRSLQWDQGRFRPR)HUQDQGRGH6]\V]OR ULVDV >ÀJ@5 Sergio Sí. No me parece casual que la opción que varios de nosotros asumimos fue retirarnos de la universidad. El paso de Helmut fue tan inesperado que luego de su partida la universidad se cerró sobre 6. El gobierno nacionalista de Juan Velasco Alvarado se inicia con un golpe militar en octubre de 1968 y dura hasta 1975, en donde es depuesto por el general Francisco Morales Bermúdez. Luego de una serie de huelgas y movilizaciones en 1977 el gobierno convoca a elecciones generales para una Asamblea Constituyente que se instala en 1978. Al año siguiente se discute y se redacta la Constitución de 1979. Siguiendo la nueva carta constitucional se convoca a elecciones generales para elegir al Presidente de la República el 18 mayo de 1980. El día de las elecciones el grupo subversivo Partido Comunista del Perú – Sendero Luminoso (PCP-SL) 74 sí misma para que las siguientes generaciones no encuentren sus huellas. Hay una discontinuidad, la experiencia que él dejó fue en personas que se dispersaron, y los que se quedaron o regresaron a la universidad como profesores no son aquellos que han metabolizado esta experiencia. 75 declara la guerra al Estado quemando una serie de ánforas electorales en el distrito de Chuschi, en Ayacucho. 7. La Colonia Penal Agrícola del Sepa (conocida coloquialmente como El Sepa o incluso El Cepa) fue una penitenciaría peruana sin muros, enclavada en una región considerada aislada de la selva amazónica, que estuvo en funcionamiento entre 1951 y 1993. Actualmente alberga un centro ganadero propiedad del Instituto Nacional Penitenciario. 8. La revista Sociedad y Política fue una publicación fundada y dirigida por Aníbal Quijano entre 1972 y 1983, con un comité editorial formado por Heraclio Bonilla, Julio Cotler, César Germaná, Rodrigo Montoya, Felipe Portocarrero, Ernesto Yépez y Abraham Zevallos, entre otros. La revista desarrolló un análisis social marxista abierto con críticas frontales al gobierno militar –que le costó la deportación a QuijaQR\D&RWOHU²UHÁH[LRQHVSHUPDQHQtes sobre la realidad nacional y de América Latina, convirtiéndose en una de las publicaciones de mayor avanzada del continente. acomodadas o altas, o también a aquellas personas que quieren parecerlo. 9. En el argot peruano ‘pituco’ es un término que puede ser usado de manera crítica, paródica o despectiva, en referencia a las personas que provienen de clases sociales etapa de colegio. Yo dejo el colegio particular donde estaba estudiando porque mis padres no podían pagarlo y me trasladan al colegio nacional Melitón Carvajal. Alfredo ¡Donde yo estudié! Entonces tú eras un pituquillo9 y de pronto aterrizas en el Melitón Carvajal… (risas) ¿y qué pasó? El contexto político y cultural Alfredo $ÀQHVGHORVVHWHQWDHOJRELHUQRPLOLWDUGH9HODVFRVHKDEtDDFDEDGR\ODVHOHFFLRQHVGH Sergio En el Melitón Carvajal mi experiencia tiene que ver principalmente con violencia entre adoles- VHDFRPSDxDQFRQHOLQLFLRGHXQFRQÁLFWRDUPDGRLQWHUQR ¿Cómo afectó eso a la ‘situación’ Chaclacayo? ¿O lo gravitante fueron solo sus vínculos interpersonales y afectivos? centes: golpes, acoso sexual, ese tipo de cosas. Pero la parte decisiva es el proceso alrededor del paro de 1977 y la larga huelga del SUTEP. Todos participábamos. ¡El Melitón lo llegamos a tomar! Botamos a los profesores, a los auxiliares y todo. Esa acumulación de hechos produce un tipo de subjetividad. Por su lado, Raúl viene de una familia pudiente de limeños y serranos híper católicos. La mamá era la pituca peruana, el papá era el típico terrateniente de la sierra, al punto que cuando la madre está embarazada en Huancayo ellos vienen a Lima para que Raúl nazca aquí y no sea un huancaíno. La madre muere joven y Raúl es criado por una trabajadora doméstica de la sierra. Finalmente su mamá sí es más huancaína que su madre sanguínea. Raúl siempre guardaría una memoria áspera de su padre por ser un gamonal abusivo como los personajes de las novelas de Arguedas. Él desarrolla luego una adolescencia en Lima en la que ingresa a un proceso de reconocer su sexualidad, buscando afectividad e intercambios con desconocidos. Esos son los dos entramados que ingresan al Grupo con nosotros. Evidentemente si hurgas un poco más allá te das cuenta que estas experiencias te hablan de cuestiones históricas profundas sobre cómo el Perú está constituido sobre un complejo colonial que divide la costa del resto del país, sobre un complejo católico que limita las posibilidades de tu vida sexual, así como VREUHXQDEUHFKDDELVPDOGHFODVHVTXHHVODEDVHGHORVFRQÁLFWRVVRFLDOHV$VtTXHSRUXQODGRWHQtDmos a alguien como Raúl que se rebela ante esa construcción familiar terrateniente, y al otro lado a alguien que venía de ver a su papá en la cárcel por politizado y revoltoso. Y esa convergencia de experiencias de la historia peruana se junta con una persona judía que había nacido en Alemania en 1937, y que se salvó de no haber sido asesinado en la Segunda Guerra Mundial. 6 Sergio Ambas dimensiones fueron gravitantes y estuvieron siempre conectadas. Insisto en el tema de la relación personal, sin embargo quiero que quede claro que no intento romantizarla. Lo que digo es que desde mi perspectiva son las relaciones afectivas el lugar donde se genera todo. Pero evidentemente no tengo un culto a los héroes. Alfredo ([WLHQGRHOFRQWH[WRGHPLSUHJXQWDXVWHGHVVRQHVWXGLDQWHVGHDUWHRFXUUHXQFRQÁLFWR interno y se alejan a un lugar fuera de Lima para desarrollar un proyecto que dura siete años. De esa experiencia, la única huella pública es la muestra en el Museo de Arte en 1984. Cuando se produce esa exposición se trata de una irrupción feroz, es un aerolito que llega y estalla en el centro del poder simbólico del arte. Las esquirlas de eso siguen hasta hoy, los muertos y heridos se pueden contar dentro y fuera de ustedes. Esa exposición ha terminado teniendo latencia en el tiempo, sin embargo, la experiencia previa de ustedes es mucho más larga y tiene otros orígenes y desenlaces... Sergio Entiendo. ¿Cómo ocurre esa ‘situación’ Chaclacayo, y por qué digo que la relación es el momento para que algo, sea lo que sea, se potencie? Voy a hacer un poquito de pre-historia y pasar a las memorias personales. ¿Qué traigo yo? Yo vengo de una familia politizada. Mi papá, Abraham Zevallos, ya había estado en la cárcel como preso político un par de veces, había estado en El Sepa de la Selva7, produce una revista con Aníbal Quijano, César Germaná, Felipe Portocarrero y otros compañeros. Esa revista la ataca Velasco durante el régimen militar, y es allí cuando deportan a Aníbal y a otras personas. Alfredo ¿Cuál es el nombre de la revista? Sergio Sociedad y política.8 En esos años mi padre no había aparecido como editor de la publicación sino como una persona encargada de labores de producción práctica y por eso se salva de ser deportado. Ese es un primer contexto. Un segundo contexto sería cuando entro a la pubertad y durante mi Jaime Helmut también trabajó mucho con la memoria de su madre… Sergio ([DFWDPHQWH(OSDSiGH+HOPXWVHFRQYLHUWHDOFULVWLDQLVPR\VHDÀOLDDO1DFLRQDO6RFLDOLVPR y ello hizo que su madre -que era judía- y su padre se separen, no un divorcio pero sí un distanciamiento. La madre lo lleva siendo un pequeño niño a una familia no judía para que lo cuide y salve su vida, evidentemente ella no iba a poder escapar con su hijo. Helmut nunca llegó a enterarse qué pasó con su madre, no sabe con qué estrategia sobrevivió en medio de la Segunda Guerra. Después se han reencontrado y su mamá no se lo ha contado. Somos tres personas que han crecido en encrucijadas de FRQÁLFWRVSROtWLFRVPX\LQWHQVRVGLVWLQWRVSHURHQDOJXQDPHGLGDHTXLYDOHQWHV<RFUHRTXHHVRKL]R que ese triple choque tenga una densidad particular en cuanto a una intencionalidad estética que fue 76 77 3DUDXQDVLJQLÀFDWLYDFUyQLFD sobre Los Bestias, véase Elio Martuccelli, “La arquitectura y el desborde urbano,” en Arquitectura SDUDXQDFLXGDGIUDJPHQWDGD ,GHDVSUR\HFWRV\HGLÀFLRVHQOD Lima del Siglo XX (Lima: Universidad Ricardo Palma, 2000). 11. Sobre la experiencia de E.P.S. Huayco véase Gustavo Buntinx, ed. (36+XD\FR²'RFXPHQWRV (Lima: CCE, MALI, IFEA, 2005). muy agresiva. Creo también que estas experiencias tan difíciles hicieron que nos sintamos vulnerables o poco hábiles en las relaciones sociales, y quizá eso ayudó a que nos encerremos. fue muy importante para nosotros pero no sabría precisar cuanto, y hubiera podido ser más gravitante pero ustedes desaparecieron, no había dónde encontrarlos. Y bueno, en realidad nuestro mundo no era el arte, nosotros éramos arquitectos. Alfredo A eso iba. Hay una serie de características singulares de esta colectividad Chaclacayo. Preci- samente lo que ustedes hacen es visibilizar algo absolutamente íntimo, que luego se siguió manteniendo íntimo y con escasa interacción hacia fuera. Sergio Sí. Luego de hacer público nuestro trabajo perdimos la oportunidad de conectar con la escena HQODH[SRVLFLyQ>ÀJ@ de Lima. Y eso tiene que ver con nuestra conducta, que era también una estrategia de Helmut que buscaba crear un espacio de independencia y distancia del entorno inmediato. Él pensaba que si nos quedábamos a cierta distancia había mucho más garantías de llegar más lejos en nuestra exploración. Y funcionó, pero también creó dinámicas problemáticas, en particular la construcción de esta estructura tan cerrada en sí misma que desaprovecha la posibilidad de expandirse y mezclarse con otras cosas. Porque al convertirnos en un ente que se protege y se cuida a sí mismo es como si tuviéramos miedo de contagiarnos de los otros. Sergio &ODURSHURPHUHÀHURDTXHQRQRVKD\DPRVYLQFXODGRGLUHFWDPHQWH\SURGXFLGRMXQWRV$OD Alfredo Es paradójico que teniendo ustedes y su trabajo una voluntad híper contaminante sea la distancia te das cuenta de que se perdió una oportunidad de haber multiplicado ese micro-movimiento. propia dinámica de grupo lo que no les permite ninguna posibilidad de ser contaminados. Alfredo Yo quería decir lo mismo pero al revés. Hablando desde mi experiencia: en ese momento no- Miguel ¿Tenían ustedes idea de lo que empezaba a surgir en los márgenes culturales? Es decir, los FRQFLHUWRVGHODPRYLGD¶VXEWH·ODJUiÀFD\SXEOLFDFLRQHVTXHHVWDEDKDFLHQGR-DLPH>+LJD@\PXFKRV RWURVORVUHFLWDOHV\ODSRHVtDGH.ORDNDGRQGHSDUWLFLSDEDWDPELpQ)ULGR>0DUWLQ@ORVSULPHURV Bestiarios, entre otras cosas. Sergio A mí me parece una gran pérdida el que no hayamos conocido a varios de ustedes que esta- ban ya haciendo cosas... Alfredo Pero nosotros –entonces formaba parte del grupo Los Bestias– sí los conocimos a ustedes sotros, Los Bestias, estábamos haciendo un proyecto llamado Deshechos en Arquitectura (1984), que HUDLQWHUYHQLUHOFDPSXVXQLYHUVLWDULRFRQFRQVWUXFFLRQHVKHFKDVFRQEDVXUD>ÀJ@10 Y recuerdo que Herbert Rodríguez llegó un día y dijo: “Hay un colectivo, un grupo que va a inaugurar en el Museo de Arte, vamos a verlo”. Y cuando fuimos nos encontramos con que ustedes eran nuestros primos hermanos. O sea, estaban con esta estética del material, de la precariedad y la exposición del cuerpo, ¡pero ustedes eran un millón de veces más políticos que nosotros! Todo este uso del cuerpo como un vehículo que interpelaba fuertemente las construcciones sociales era simplemente demasiado. El nivel de politización que ustedes estaban planteando era de una radicalidad casi insoportable, y sin embargo, WUDEDMDUGHVGHHOERUGHGHVGHORYXOQHUDEOHGHVGHGHVHFKRVUHVLJQLÀFDGRVHUDORTXHQRVKDFtDHVWDU totalmente conectados sin habernos visto nunca las caras. Fue Herbert el que hizo esa conexión que SDUDQRVRWURVIXHLQHVSHUDGD\IXOPLQDQWH>ÀJ@ Sergio No, no tuvimos vínculo con ninguna de esas cosas, sí referencias lejanas pero sin conexión. Alfredo Estaban viviendo en su monasterio, autofagocitándose… (risas) Jaime En ese año hay varias cosas que comenzaron a suceder. Por ejemplo, ver en televisión la matanza un año de diferencia. de la cárcel El Sexto en marzo de 1984… Ver esas cosas iba anunciando que la institucionalidad se estaba disolviendo. Ese tipo de imágenes nos hizo avanzar más rápido, desesperadamente. Yo dejé la Universidad Católica porque me dije: “Carajo, si están encontrando fosas comunes y cayendo bombas por todos lados, ¿quién va a comprar cuadros?” (risas). Entonces empecé a parar con mis amigos con quienes intercambiábamos discos. En un primer momento, tengo que decirlo, era música progresiva. Alfredo 1RORVDEtD«0HYR\DDWUHYHUDGHFLUORVLJXLHQWHVHKDEODPXFKRGHODLQÁXHQFLDGH Alfredo ¡Todos escuchábamos rock progresivo! Jaime Herbert conocía muy bien a Raúl. Ellos se conocían porque habían estado en la universidad con E.P.S. Huayco (1980-1981) para todo el arte radical de los años 80.11 Pero por ejemplo, nosotros >/RV%HVWLDV @QXQFDFRQRFLPRVD+XD\FRQXQFDYLPRVQDGDGHHOORVHUD+HUEHUWTXLHQ KDEtDVLGRSDUWH\YHQtDDFRQWDUQRVKLVWRULDV\PRVWUDUQRVÀJXULWDV>ÀJ@£3HURFRQTXLHQHVVt convivimos aún sin conocernos fue con ustedes a través de su exposición en el museo! Esa presencia Jaime Y me acuerdo que un día fui a la casa de un amigo, Martín Berninzon, y descubrí a Bowie cuando tocaba con Brian Eno. Y luego comencé a escuchar a Sex Pistols, me pareció natural esa transición. Y de repente al dejar la universidad me di cuenta de que mis amigos con quienes intercambiaba discos 78 79 12. Narcosis fue uno de los primeros grupos de punk rock local, cuya única maqueta Primera Dosis fue una de las grabaciones emblemáticas de la escena ‘subte’. Sobre ello véase Carlos Torres Rotondo, Se acabó HOVKRZ(OHVWDOOLGRGHOURFN subterráneo (Lima: Editorial Mutante, 2012). (2011), pp. 42-58. Véase también Rachel Weiss HWDO0DNLQJ$UW *OREDO 3DUW 7KH7KLUG+DYDQD Biennial 1989 (London: Afterall, Academy of Fine Arts Vienna and Van Abbemuseum, 2011). 13. Sobre el envío de la la obra de NN a la Tercera Bienal de la Habana de 1989, véase Miguel A. López, “Revolución Cultural y Orgía Creativa: El Taller NN (1988-1991). Entrevista con Alfredo Márquez,” en Illapa Revista del Instituto de Investigaciones Museológicas y Artísticas de la Universidad Ricardo Palma, n. 8 comenzaron a hacer sus bandas. Un día voy a la casa de Wicho García y él me dice: “Puta, Cachorro >)HUQDQGR9LDO@PHKDGLFKRSDUDFDQWDUHQVXJUXSR¢TXpKDJR"µ(QWRQFHVOHGLJR´¢7LHQHVRWUD cosa qué hacer?”. “No”. “Métete pues”. Y se metió. Alfredo A Narcosis >ÀJ@12 La exposición en el Museo de Arte Alfredo (VRSLHQVRWDPELpQ(VFRPRTXHQROHVFRUUHVSRQGH8VWHGHV>UHÀULpQGRVHD-DLPH\)ULGR@ eran sus compañeros en la universidad, luego estos chicos la dejan para irse con Helmut y de pronto estos disidentes tienen una gran muestra en el Museo de Arte de Lima. ¿Cómo procesar eso? ¿No es raro? Jaime Exacto. En ese momento Cachorro tenía una energía alucinante. Era puro do it yourself, sacar las cosas en fotocopia, sacar la maqueta... Él fue un gran motor y muchas cosas que hicimos nacieron a partir de su entusiasmo. Jaime Claro, pero muchos de nosotros ya estábamos enterados de lo que estaban haciendo en esa Sergio Es interesante que menciones la matanza en El Sexto. Todos los materiales periodísticos que Alfredo “¡Los han secuestrado!” (risas) dieron cuenta de esas matanzas fueron importantes para nosotros. Nosotros veníamos ya acumulando material, juntamos rumas inmensas de La República, El Diario, Amauta y otros. Si bien es cierto que teníamos una ceguera hacia lo que pasaba en la escena contracultural sí estábamos mirando con lupa todo lo que ocurría en la visualidad política, que era el material que estaban usando también todos ustedes. Jaime Claro, era una misma fuente de información. Sergio Gracias a estas imágenes de prensa y mensajes televisivos es que nuestras producciones podían ser cercanas sin habernos conocido. Pero yo no diría que la institucionalidad se estaba diluyendo sino que estaba haciendo su aparición un Estado fascista, el cual estaba preparándose para una guerra. Y quizás más bien quienes estábamos soñando con diluir esa institucionalidad éramos nosotros, con nuestros intentos de desmantelar lo visual, lo sonoro, y crear productos que escapasen a la lógica autoritaria, que destruyesen esa lógica. Lo que estaba ocurriendo con la institucionalidad era una conversión a posiciones maniqueas, negro o blanco, bueno o malo, vivo o muerto, y nada más. Jaime Es curioso que en los periódicos aparecían muchas noticias de violencia y muerte pero la gente no podía aceptar que las representaciones simbólicas y artísticas aludieran a lo que estaba pasando >ÀJ  ÀJ@(QWRQFHVORVFRQFLHUWRVVXEWHVHUDQFHQVXUDGRVRFXDQGR1DUFRVLVLQWHUSUHWDSucio policía en un festival los policías hicieron disparos al aire y todo se dispersó. casa en Chaclacayo. No pensabas “Helmut se ha llevado a Sergio y a Raúl…” Frido Sí, por supuesto que sorprendía, ¡y mucho! No solo porque eran jóvenes como nosotros, de un mismo grupo generacional que andaba buscando cosas en los márgenes, sino además porque se WUDWDEDGHXQDSURSXHVWDSURIXQGDPHQWHYLVFHUDOHQXQHVSDFLRWDQRÀFLDOVROHPQHWDQLQVWLWXFLRQDO como era el Museo de Arte. Alfredo Yo era de arquitectura y soy sincero al decir que lo último que nos importaba de lo que hacía- mos era su condición artística. No nos importaba una puta mierda el arte, lo que nos interesaba es la DFFLyQItVLFDGHXQFXHUSRHQHOHVSDFLRSURGXFLHQGRUHSUHVHQWDFLRQHVVLPEyOLFDVTXHPRGLÀTXHODV relaciones productivas y afectivas. Entonces, para nosotros la exposición fue un total descubrimiento SHURQXQFDLPDJLQDPRVODPDJQLWXGGHORTXHVLJQLÀFySDUDORVFRPSDxHURVGHOPXQGRGHODUWH Sergio, ¿qué es lo que ocurrió para que eso suceda? Esa pregunta me intriga. Cuento algo de mi experiencia: luego de que se disuelve el colectivo Los Bestias varios nos organizamos y formamos el Taller NN en 1988, y de pronto al año siguiente NN es invitado en la III Bienal de Arte y Arquitectura de la Habana (1989). Y toda la gente aquí en Lima dijo: “¿Quiénes son estos?” Se nos ha dicho literalmente: “Sin saber leer ni escribir han ido a representar al Perú en este importante evento de arte”. Lo que ocurrió en nuestro caso fue que se cruzó el asteroide Gerardo Mosquera quien se interesó en nuestra producción.13 Pero no había nada en las trayectorias naturales de nuestros cuerpos que pudieran llevar a esa situación de exposición artística internacional. Sergio En nuestro caso fue un oportunismo político que Helmut supo aprovechar muy bien… Sergio Claro, es importante pensar las circunstancias en Lima al momento de considerar qué pudo o no realizarse, sobre todo tratándose de conciertos, performances, intervenciones, que son situaciones donde uno está expuesto. Dentro de todo, tuvimos suerte en haber podido hacer esa exposición en el museo. Alfredo ¿Oportunismo de quién? Sergio De quienes entonces eran las autoridades del Museo de Arte. El museo ahora es distinto de lo TXHIXHHQWRQFHVGHKHFKRODFRQÀJXUDFLyQPLVPDGHOHVSDFLRHUDWRWDOPHQWHRWUD(ODOFDOGHGHHVH 14. Sobre Kloaka, véase Juan Zevallos Aguilar, .ORDNDDxRV GHVSXpV0.  &XOWXUD juvenil urbana en la postmodernidad periférica (Lima: Editorial Ojo de Agua, 2002); y José Antonio Mazzotti, 3RpWLFDVGHO)OXMR0LJUDFLyQ\ violencia verbales en el Perú de los 80 (Lima: Fondo Editorial del Congreso del Perú, 2002). 80 81 momento, Eduardo Orrego, tenía la idea de restaurar el museo de forma espectacular. Y sucede que DXWRULGDGHVGHOPXVHRKDEtDQRtGRTXHXQFUtWLFRPX\LPSRUWDQWHHVWDEDLQWHUHVDGRHQXQHGLÀFLRGLseñado por Eiffel que era el Palacio de la Exposición “donde está ubicado el Museo de Arte”, entonces logran traerlo a Lima para hacer un pequeño seminario con la gente interesada. El nombre de este crítico es Wieland Schmied, director del DAAD (programa de intercambio académico alemán), y que luego sería director de la academia de Munich. Evidentemente Helmut también se entera a través del Goethe Institut de Lima de esta llegada y le pide al director que le envíe información a Wieland sobre el trabajo que veníamos realizando en Chaclacayo. Wieland decide visitarnos y se queda fascinado con el proyecto. Su interés fue genuino y escribió incluso para el catálogo. Lo que ocurrió es que la Municipalidad, con Orrego a la cabeza y los Miró Quesada en el patronato del Museo de Arte, estaban especulando sobre la idea de recibir de parte de Alemania una inversión millonaria para restaurar el museo. Habían planteado un diseño arquitectónico espectacular que incluía desde el Parque de la Exposición hasta el Centro Cívico. Y el único contacto que tenían era el señor Schmied. Helmut y Wieland hablaron sobre eso, muy conscientes de cómo funciona la política local y las posibilidades de corrupción que había detrás de ese gran proyecto. Así, Wieland se distancia de ser usado para traer ese dinero, pero como seguía fascinado con nosotros decide jugar una carta y le dice al Patronato que éramos lo mejor que había en producción artística. El señor Miró Quesada envía entonces al director del museo, Felipe Ontiveros, para que nos visite y vea nuestro trabajo. Lo que ocurre a su regreso de la reunión del Patronato me lo ha contado él mismo: “Señor, quiero informar sobre lo que he visto en la casa en Chaclacayo…” Y le responden simplemente: “Haga la exposición”. Y dice: “Sí, pero...”. “Haga la exposición”. “Pero yo creo que ustedes deberían enterarse de...”. “Haga la exposición” (risas). Y la exposición se hizo. Alfredo “Esa mierda no va más, y cualquier mierda de ese tipo me la apagas porque no es posible”. Alfredo ¡De esto está hecha la historia verdadera! Eso es súper importante porque ves cómo se mueven Frido O lo que hacía Kloaka… los agentes del poder tras bambalinas. Tener una presencia pública con ese nivel de impacto como lo de ustedes solo es posible porque hay agentes políticos, coyuntura. Alfredo Claro. El momento de intensidad de esta ola podría ser 1984. Ese año coincide la exposición No había en esos años un equivalente a lo que es hoy el Cardenal Juan Luis Cipriani, es decir alguien que sintetice toda la dimensión oscura, violenta y manipuladora del poder, pero sí había muchos agentes con un poder más disuelto preocupados en construir algo que haga que nunca más se repita ese nivel de desobediencia. No es solamente borrar lo que ustedes hicieron sino las huellas sembradas en los propios cuerpos que los vieron. No hay nada que haya ocurrido después que haya tenido ese nivel de laceración y perversidad simultánea que ustedes desplegaron. Sergio Eso tiene que ver también con cómo funciona nuestra sociedad. Pensemos por ejemplo el nivel de destructividad que posee el aparato estatal, es alucinante. Toda esa euforia política que viene después del gran paro de 1977 se desarticuló muy poco después. ¿Cómo una sociedad que tenía un nivel tan alto de politización y voluntad de organización deriva en la entidad completamente despolitizada y atomizada que ahora vemos y vivimos? Contramemoria de los 80 Sergio No es casual que muchas de estas iniciativas contraculturales a las cuales nos hemos referido QRKD\DQVLGRD~QVXÀFLHQWHPHQWHUHYLVDGDVQLSROtWLFDPHQWHSURFHVDGDV\KDVWDFLHUWRSXQWRKDEL OLWDGDVFRPRSDUWHGHXQDPHPRULDFROHFWLYDSRVLEOHPHUHÀHURDODHVFHQDVXEWHHOWUDEDMRGH/RV %HVWLDV\ODVH[SHULHQFLDVFRQ+HUEHUW5RGUtJXH]HQOD&DUSD7HDWURHOWUDEDMRJUiÀFRGH7DOOHU11HO WUDEDMRGH7HDWURGHO6RO«>ÀJ@ puerta, y te metes. Pero es efectivamente eso: un momento. GHO*UXSR&KDFODFD\RHQHO0XVHRGH$UWHQRVRWURV>/RV%HVWLDV@FRPHQ]DPRVFRQORVDeshechos en Arquitectura y a organizar los primeros Bestiarios que tejen articulaciones con el rock, el teatro, artes plásticas; y también los momentos intensos de Kloaka… Alfredo Ustedes capitalizaron muy bien la situación logrando mucha visibilidad, pero tiempo después Sergio Frido, cuando tú nos venías a visitar y participabas en nuestras acciones, ¿ya estabas en para- fueron castigados por ese atrevimiento. Y ese castigo ha pendido sobre la memoria de la colectividad Chaclacayo hasta hoy. En ese sentido esta nueva exposición que estás organizando Miguel es muy importante, pero no para reivindicarlos sino para volver a pensar el nivel de insolencia inmanejable que la presencia del Grupo puso sobre la mesa. Y estoy seguro que otras cosas van a saltar. lelo en Kloaka? Sergio Claro. Cuando te das cuenta de lo que está ocurriendo pones el pie para que no se te cierre la Sergio Claro, de hecho luego de la exposición de 1984 hubo otra especie de consenso tácito de que algo así no podía ir en el museo nunca más… Frido Sí. Conocí primero a José Antonio Mazzotti y a Eduardo Chirinos en la Universidad Católica. Y es a través de Mazzotti que conozco a Roger Santiváñez, quien había sido cercano de alguna manera a la experiencia del colectivo de arte E.P.S. Huayco (1980 -1981). También fue cercano a Huayco el SLQWRU(QULTXH3RODQFRTXLHQSDUWLFLSyWDPELpQGH.ORDNDGLVHxDQGRORVDÀFKHVGHUHFLWDOHV\FRQFLHUWRV>ÀJ@141RPLOLWpIRUPDOPHQWHHQ.ORDNDSHURKDEtDXQDDÀQLGDGPX\IXHUWHSDUWLFLSDEDHQ 82 los eventos que ellos hacían y en paralelo los conocí a ti Sergio, a Raúl y a Helmut. Mi primer encuentro con ustedes fue cuando estaba en la universidad estudiando literatura. A mi me gustaba pasar por la facultad de arte rumbo a mi casa y ver qué es lo que estaban haciendo, así que un día me topé con Raúl y Sergio, y nos quedamos conversando. Luego de unos días me doy cuenta que esta escultura que estabas haciendo es la cosa que luego sacaríamos en una procesión por los alrededores de la XQLYHUVLGDG5HFXHUGRTXHW~>6HUJLR@PHGLMLVWH´2\H)ULGR¢TXpWHTXHGDVDKtYLHQGR"$\~GDPHD terminar esto”. Por ahí cerca también estaban Fernando Bryce a quien ya conocía porque tocaba en XQJUXSRFRQ5RGULJR4XLMDQROODPDGR'XUD]QR6DQJUDQGR>ÀJ@15 Yo no tenía aún tanto contacto FRQODVDUWHVYLVXDOHVSHURPLDÀQLGDGFRQXVWHGHVIXHLQPHGLDWD/RGH+XD\FRPHSDUHFtDLQWHUHVDQte pero lo que veía en ustedes era de una fuerza muy particular, que se enlazó con mi búsqueda de vincular lo literario, lo visual, lo sonoro, lo corporal. Yo en esa época andaba totalmente metido en la SRHVtD0LVUHIHUHQWHVPiVIXHUWHVHUDQHOVXUUHDOLVPR\WRGDODRQGDGHÀQHVGHORVODLQÁXHQFLD de las protestas de Mayo del 68. Y quizás por eso me parecía fascinante que una persona como +HOPXWTXHHUDJHRJUiÀFD\JHQHUDFLRQDOPHQWHGHHVHPRPHQWRHVWXYLHUDURQGDQGRORVHVSDFLRV de la universidad. 83 El presente Sergio Veo en nosotros instantáneas de esa época, cuerpos con una intencionalidad de intervenir en XQPRPHQWRHVSHFtÀFR<ORTXHQRVUH~QHDKRUDHVWDPELpQHOKHFKRGHTXHHVWDPRVDFWLYRVDWUDYpV GHSUiFWLFDVTXHHQFXDQWRDVXHVHQFLDQRGLÀHUHQWDQWRGHORTXHKDFtDPRVHQWRQFHV(QWRQFHVPH asalta una curiosidad, yo tengo la impresión de que cuando nosotros iniciamos estos experimentos, FRQWRGRORFRQÁLFWLYR\DJUHVLYRTXHHUDHQHODPELHQWHKDEtDXQDLUHPiVFDUJDGRGHHVWDVLQWHQFLRQHV No era difícil encontrarse a alguien que simpatizase contigo o que te acompañase para hacer algo que W~FRQVLGHUDEDVLPSRUWDQWH2TXHHVWDOOHQDWXDOUHGHGRULGHDVWRGRHOWLHPSRDXQTXHHVWDVÀQDOPHQWH no se concretaran. Había la permanente efervescencia de una indisciplina. Y ahora yo siento en mis encuentros con artistas de treinta años o menos que hay un ambiente muy conservador, bien normado, como que todo el mundo se porta bien. Frido 2PiVVXSHUÀFLDO¢QR" Sergio Sí, mucho. No sé si ustedes lo ven igual y a qué lo atribuirían. Sergio Claro, tú ibas regalando tus escritos, recuerdo uno que dice “Osiris es un dios negro…” Ese poema lo tengo. Alfredo Yo creo que la guerra interna la ganó el fujimorismo como paradigma. Vivimos los tiempos no un lado ese nivel agudo del lenguaje asociado a tu vínculo con Kloaka, y por otro la experiencia performativa y sexual que tenías cuando nos visitabas… del post-fujimorismo, sino de la plenitud del fujimorismo, así de claro lo diría. Nosotros cuatro más bien hemos sido formados en un momento donde las cosas estaban dadas por tu capacidad de ser creativo a partir de la educación, nuestros padres se sacaron la mierda para que accediéramos a la educación. (OSDUDGLJPDGHOFXDOKHPRVEHELGRHVTXHODHGXFDFLyQWHKDUiORTXHVHDSRGHURVRHÀFLHQWHOLEUH lo que fuera. Y cada uno de nosotros cogió lo que mejor pudo, pero esa generación no existe más, y no digo que sea mejor solamente que es otra. Frido Hay una cuestión importante que me unía a Kloaka: el intento de sacar la poesía del papel y Sergio ¿Y cuál sería el paradigma según el cual se orientan las generaciones actuales? Frido (VRHUDXQSDQÁHWRHQUHDOLGDGTXHUHSDUWtHQODXQLYHUVLGDG Sergio 3DUDPLWXSRHVtDHUDPX\VRÀVWLFDGD¢&yPRVHMXQWDQHVWRVGRVDVXQWRVHQWXSHUVRQD"3RU HVWDEOHFHUYtQFXORVHQWUHSRHVtDYLGD\DFFLyQ/RTXHPHXQLyDXVWHGHV>*UXSR&KDFODFD\R@IXHDOJR que yo interpreté como experimentar el mundo desde una posición vinculada a los afectos, algo que percibí desde que decidieron irse a vivir juntos. Ambas experiencias estaban intentando lidiar con la represión, pero creo que lo más oscuro de lo que se vivía entonces lo llegaron a simbolizar ustedes, sobrepasando las gramáticas visuales más tradicionales y políticas en un sentido literal como ocurrió con otros artistas de la escena contracultural. Lo que ustedes hacían era profundamente político. Las series de fotografías donde colaboro contigo Sergio, por ejemplo Rosa Cordis (1986) o Detritus (1986), responden a una serie de preguntas que nacen del espacio íntimo pero mezcladas con un LPDJLQDULRGHOH[WHUPLQLRDVÀ[LDQWHSDUDPtWRGRHVRIXHPX\OLEHUDGRU&UHRTXHORTXHPHJXVWDED era la manera en que deshacía totalmente mi experiencia más cómoda de clase media. Alfredo El fujimorismo implicó la destrucción del cuerpo social como tejido vivo. Lo que vivimos ahora es un tejido como gangrena, que está detenido, sin tránsito, es un tejido muerto, que va produciendo células –sigue naciendo gente– pero sin capacidad de conexión y de generación de redes. La pregunta es si resulta posible convertir eso en tejido vivo nuevamente. Y no es que no haya producción intensa \GHFDOLGDGHVRH[LVWHHOSUREOHPDHVTXHVXVLJQLÀFDGR\FDSDFLGDGGHLQWHUDFFLyQVRFLDOPiVDOOi de su entorno inmediato es casi inexistente. Por eso decía que la carencia de tejido hace que esas representaciones creativas no representen a nadie más que a los mismos que están creándolas y a los que las fagocitan, punto. 84 85 Sergio Y ahí se quedan. política o poética sino que sencillamente decidieron convertirse en piezas del establishment, y supieron entender que eso los iba a capitalizar. Ellos han sido la generación de recambio. Nosotros tenemos un promedio de cincuenta años, es nuestra generación la que está en el poder. Y no estoy hablando necesariamente de nuestros compañeros del colegio o de la universidad, sino de todo un grupo de gente que toma las decisiones en este país, los que administran la economía, los que deciden las políticas públicas. Entonces nosotros seguimos haciendo lo nuestro pero es un poco como jugar de jovenzuelos. Frente a ese consenso que dice que las imágenes no importan mi posición es contraria, yo sí creo que el mundo simbólico tiene su pertinencia y no importa si no estás a cargo de las políticas S~EOLFDVGHUHSHQWHFRQWXVSHTXHxRVDFWRVHVWiVLQÁXHQFLDQGRVXEMHWLYLGDGHVTXHSXHGDQORJUDU cosas más poderosas de lo que nunca imaginaste. Alfredo Claro. Seguramente hay alguien que está haciendo sonido post-industrial alucinante pero co- OHFWLYDPHQWH¢TXpVLJQLÀFD"¢4XLpQHVVHLGHQWLÀFDQFRQpO"¢4XpWHMLGRYDDUWLFXODQGR"1RVHVWDPRV dirigiendo hacia la atomización absoluta y ya nadie va a tener tiempo para hacer nada más que producir plata para un capitalista que está encima de ti, administrando todo para otro que está por encima de él. El paradigma neoliberal llevado al extremo. Sergio Quizá la manera de enfrentar todo ello tiene que ver con la cercanía, con la proximidad. Alfredo Sí. Tal vez está vinculado a algo muy bonito que comentaste hace un momento. Dijiste que en esos años siempre ibas a encontrar a alguien que te acompañe a hacer algo “que tú considerabas importante”, y yo iría incluso más lejos: no solamente es que era importante lo que hacíamos sino que eso era precisamente lo que nos hacía como sujetos. O sea, estar en un concierto o en un recital de Kloaka me hacía, había algo que me permitía seguir existiendo simplemente por ese estar intercambiando energía con otros cuerpos en ese espacio. Eso también me pasó al ver la exposición que ustedes hicieron en el museo, yo era con ustedes pero era sobre todo conmigo, y era con un nosotros, estaba muy consciente de que esa situación nos estaba construyendo. Y esta idea de la construcción no es una noción positivista, no es llanamente la idea de ser-más como mera acumulación, menos en un momento político donde podía ocurrir algo que te podría dejar destrozado en cualquier instante. Ahora hay millones de cosas que suceden y no tienen la más mínima importancia o la capacidad de afectarte. La gente va al encuentro de cosas y el diálogo es absurdo: “¿Qué tal esto?” “Ahí, bien, normal, me gustó”. Parece una estupidez lo que estoy diciendo pero es importante. Antes en esas cosas te jugabas la vida. Sergio El hecho de jugarte la vida es algo que estaba muy presente. Alfredo Sí, creo que eras más consciente de que te la estabas jugando. ¡Lo complicado es que ahora también te la juegas pero no te das cuenta! No te das cuenta porque estás vegetando. ¿Cuántos jóvenes viejos hay? Sergio tú decías hace un rato: “sucede que estamos aún activos” y eso es porque estamos jóvenes pues, porque sentimos la pertinencia de seguir apostando por decir lo que queramos decir, y equivocarnos, exponernos a hacerlo. Pero hay un montón de chicos que a los treinta años ya quieren WHQHUXQDFDUUHUDDEVROXWDPHQWHUHVXHOWDFRQXQDHFRQRPtDTXHYDDVLJQLÀFDUTXHWHQJDQSDJDGRHO colegio de sus hijos y las universidades de sus nietos. ¡Sus paradigmas no tienen nada que ver con los nuestros, son ancianos a los treinta! Nosotros aún seguimos preguntándonos cosas que no tenemos resueltas para el siguiente mes. Hay otras urgencias. Pero hay también personas de nuestra generación que en un momento dijeron: “no, yo quiero garantizar mi vida”. Y no es solo que se desligaron de la Sergio Claro, hay poca capacidad de enfrentar críticamente los discursos que han instalado los pará- PHWURVGHODHÀFLHQFLDHQHOVHQWLGRGHODVHFRQRPtDVSRUHMHPSORWRGDODGHÀQLFLyQGHODVLGHQWLGDdes masculinas, el hecho de que los hombres tengan que, a partir de cierta edad, lograr tales cosas desde cierta posición. También percibo que entre la gente joven ahora y el momento en que nosotros éramos los jóvenes hay desniveles enormes de percepción y lectura de la realidad. Hoy es muy difícil plantearse una cosa extrema y sacarla adelante. Es decir, antes dentro del cuerpo social yo sentía PXFKDFRPSOLFLGDGLQFOXVLYHGHJHQWHQRGLVSXHVWDDDFRPSDxDUWHWDQOHMRVSHURVtFRPSDUWLUWXDÀnidad. Ahora siento lo contrario: son muy pocos los que realmente están dispuestos a asumir riesgos. Miguel Es cierto. En eso que ustedes llaman mi generación parece cada vez más difícil imaginar cómo el ámbito creativo puede tener una participación en la vida social y pública más allá de las dinámicas del mercado y las lógicas corporativas. Y no hablo de participación como gestión técnica, sino como la posibilidad de lo simbólico de modelar otro espacio público a través de la disconformidad, de alterar la manera en que nos relacionamos entre nosotros. Hay poca capacidad de imaginar como la estética puede colocar asuntos que consideramos urgentes como colectividad, ocupar espacios, afectar nuestras estructuras de deseo, desmontar ciertos relatos normativos y producir otras formas de subjetividad, de sociabilidad, de sexualidad, e incluso de amor en un sentido político. Alfredo De acuerdo Miguel, pero también sucede lo otro: hay gente de tu generación que cree que hacer arte político es hacer representaciones de discursos políticos y son igual de inocuos porque terminan tematizando. Cuando hablamos de política estamos hablando principalmente de la capaciGDGGHPRGLÀFDU\DOWHUDUODVUHODFLRQHVKXPDQDVQRHVWDPRVDTXtSDUDGHFLU´HVWHHVHOGLVFXUVRµ o “este es el no discurso”. Siento que se han desvanecido un poco las posibilidades de que la gente que se interesa en las políticas de la producción visual tenga una conciencia de su propio poder, y ha cedido a que su discurso y discusión sea sobre la autoridad de lo político y no tanto de la política de lo propio. Y eso lo siento tan viejo como otros que dicen: “Qué aburrida la política”. Ni lo uno ni lo otro. 15. Ver Roger Santibáñez, “Música joven: entre la chicha y el rock,” Revista de la Semana 18, suplemento de El Observador (Lima, 3 de abril de 1983). 86 16. La exposición Perder la Forma +XPDQD8QDLPDJHQVtVPLFDGHORV años 80 en América Latina fue un proyecto de curaduría e investigación de la Red Conceptualismos del Sur, producido por el Museo Nacional Centro de Arte Reina Sofía de España. La exposición presentó una revisión de los años 80, estableciendo un contrapunto entre los efectos de la violencia sobre los cuerpos y las experiencias radicales de libertad \WUDQVIRUPDFLyQTXHGHVDÀDURQHO orden represivo. Esta exposición se presentó en simultáneo a Un Cuerpo $PEXODQWH6HUJLR=HYDOORVHQHO Grupo Chaclacayo, 1982-1994. Sobre la exposición ver Red Conceptualismos del Sur, Perder la Forma +XPDQD8QDLPDJHQVtVPLFDGHORV años 80 en América Latina (Madrid: MNCARS, 2012). 17. Luis Lama, “Pobre Goethe,” Caretas, Lima, 3 de diciembre de 1984, p. 63. 18. En un extenso artículo sobre el Grupo Chaclacayo en 1983, Gustavo Buntinx compara brevemente el rumbo del colectivo E.P.S. Huayco, disuelto poco tiempo antes, con el (VFRPRQRHQWHQGHUODHVSHFLÀFLGDGGHOSRGHU9ROYLHQGRDODPXHVWUDGHO0XVHRHQ\RUHFXHUdo que quedé sobrecogido: “¡Estos huevones, cuánta carne está puesta de por medio!” Eso lo sentí, ellos estaban mostrando toda su visceralidad volcada y eso es enorme. Claro, ahora ya tenemos herramientas para entender nociones como biopolítica y teoría queer pero en ese momento no era parte del consenso de discusión, ni siquiera en los interesados. Pero no deja de parecerme paradójico que mucha gente que le interesa el arte político o politizado no usa esas herramientas. Ayer conversaba FRQÉOH[ÉQJHOHV>H[LQWHJUDQWHGH/RV%HVWLDV\7DOOHU11@\GHFtDPRV´'HDOJXQDPDQHUDGHVSXpV de estas dos exposiciones en Lima [Perder la Forma Humana y Un Cuerpo Ambulante@YDQDTXHGDU DOJXQRVLPDJLQDULRVGHUHSUHVHQWDFLyQGHORFROHFWLYRHQXQPDUFRKLVWyULFRHVSHFtÀFR/RVRFKHQWD van a tener sus imágenes”.16 ¿Y los noventa? ¿Y los dosmiles? ¿Y los dosmildiez? Al ver esas prácticas de los ochenta tú ves que hay una correspondencia con su tiempo, una capacidad brutal de representar su propio momento, pero ahora mismo es bien difícil poder percibir algo parecido, no lo se… Homosexualidad y política Miguel En las críticas en prensa a su exposición en el museo de 1984 era posible percibir un distanciamiento frente a su vocabulario homoerótico. Recuerdo el artículo de Luis Lama titulado “Pobre Goethe” donde decía que ustedes ensalzaban el ‘mito homosexual’, que eran una “parafernalia de la EODVIHPLDµDFXVDQGRVXVSUiFWLFDVFRPRXQSVHXGRDUWHTXHFDPXÁDEDXQDDSRORJtDDODPDULFRQHría.17(VRHUDFRPRXQDHYLGHQFLDGHVXLQDGHFXDFLyQIUHQWHDOHVSHFWURFXOWXUDORÀFLDOSHURODVIUDVHV de Lama son deliciosas porque esos cuerpos que él llama aberrantes, sadomasoquistas, decadentes, perversos, blasfemos, son el anuncio de los sujetos de la revolución a los que el pensamiento heteronormativo intenta poner freno a toda costa. Sergio Claro. Recuerdo mucho ese artículo, recuerdo incluso a Luis Lama en la casa visitándonos. Otro caso interesante que recuerdo fue cuando me entrevisté con el antropólogo Rodrigo Montoya. En nuestras conversaciones uno de los límites era el tema de la sexualidad. Creo que entonces fui consciente que ese es el tope para una posición crítica de izquierdas. Yo lo conocía personalmente a través de mi familia, de mi papá, la revista y su participación en la izquierda. Incluso mi propio padre tenía muchos SUREOHPDVFRQVXPDFKLVPRHOJUDQFRQÁLFWRTXHWXYRFRQPLJRIXHSRUHVRVLHQGRXQDSHUVRQDGH militancia y de vocación social crítica. Desde un lugar distinto pienso también en la reacción de voces progresistas, como la del crítico Gustavo Buntinx, quien interpreta una parte importante de nuestra exposión de 1984 como exhibicionismo. Creo que, en su opinión, cargar el trabajo de una gramática tan intensamente homosexual desde lo introspectivo hacía que el componente político se diluya o pierda fuerza. Para él las formas de articular el debate político claramente tenían otra formalización, más asociadas con un trabajo en colaboración directa con grupos organizados y procesos sociales en marcha18. Y bueno cada uno tiene una forma de entender y proyectar su entendimiento de lo político. 87 trabajo del grupo, señalando sus diferencias no sólo en términos estéticos sino también en relación a la dinámica de la producción artística desde la cual cada uno se posiciona. Para Buntinx, una importante diferencia radica en el diálogo que propone el grupo E.P.S. Huayco con los códigos de las clases populares, a diferencia del Grupo Chaclacayo que opta por un retiro de la escena que no le permite establecer vínculos con otros procesos creativos y políticos.Ver Sebastián Gris [GustaYR%XQWLQ[@´8QDH[SHULHQFLDH[WUHma en nuestro arte,” El Caballo Rojo, Lima, 28 agosto de 1983, pp. 10-11. Sobre su comentario respecto a la exposición del grupo en el Museo de Arte de Lima, ver Sebastián Gris >*XVWDYR%XQWLQ[@´¶*UXSR&KDFODFDyo.’ Los cuerpos del delito,” La Republica, Lima, 9 diciembre 1984, p. 49. Sobre la profunda investigación de Buntinx sobre el grupo E.P.S. Huayco ver referencia en la nota 11. pos feministas y por organizaciones de defensa de los derechos sexuales y reproductivos. 19. El 11 de octubre de 2013 el presidente ecuatoriano Rafael Correa amenazó con renunciar a su cargo si avanzaba la iniciativa legislativa de despenalización del aborto impulsada por congresistas de su propia bancada, a quienes tildó de “desleales”. Tras esa amenaza se retiró la propuesta del Parlamento, frustrando una vez más una importante demanda impulsada por gru- Alfredo Sí me hubiera gustado pensar una Lima muchísimo más afectada si el Grupo Chaclacayo hu- biera tenido una presencia mayor o más constante en el ámbito público luego de su primera exposición. Con ustedes estaba irrumpiendo un ejercicio inédito del uso del cuerpo en relación con las cuestiones ideológicas y la violencia. Es un mix que no se ha reeditado. Ahora, ¿qué puede pasar con esta nueva aparición de la obra en 2013? A veces no puedo evitar sentir que hay pocas posibilidades de TXHHVWHWLSRGHVLWXDFLRQHVWHQJDQÀORSHURQRSRUHOWUDEDMR²TXHVtORWLHQH\HVHQRUPH²VLQRSRU eso que comentaba que hay demasiado tejido muerto. Para que la chispa salte es necesario también TXHODVRFLHGDGWHQJDÀOR Sergio A nivel mediático no habría que esperar nada, eso está claro. Para mí la pregunta es ¿qué SXHGHSDVDUDOOtDEDMR"$VtFRPRFXDQGRXVWHGHV>/RV%HVWLDV@IXHURQDYHUODH[SRVLFLyQHQ Hay un tipo de relaciones, de cuerpos inconformes, de micro-tejido, que sí está hirviendo. Pero eso va a ocurrir fuera de la institución, en espacios no regularizados, o con las personas en sus mismos territorios y con gente de otros campos de acción política y cultural, es allí en donde ocurren las PHMRUHVLQÀOWUDFLRQHV Miguel Yo sí creo que ahora mismo hay puntos de ebullición y que están poniendo en crisis las estructuras normalizadas del cuerpo social. Sin ir muy lejos toda la ira que está desatando el proyecto de la unión civil igualitaria en Perú. Las reacciones homofóbicas que hemos visto, y que van a ser aún mayores cuando se acerque el momento de decidir, ponen en escena el límite de lo que no estás autorizado a traspasar bajo ninguna circunstancia. Y no solo aquí, hace muy poco el presidente de Ecuador, Rafael Correa, bloqueó de una manera artera un proyecto de un sector progresista de la izquierda que buscaba despenalizar el aborto en el Código Penal, ¡y se trataba de abortos en caso de violación! Y su negativa fue por su adhesión católica.19 Realmente sentí mucha vergüenza de esa izquierda que se autoproclama progresista pero que no es capaz de ver la urgencia de estas luchas transversales. Creo que muchos de los que apostamos por una reinvención del proyecto democrático desde el género y la sexualidad no tenemos mucho lugar en esos discursos de la vieja militancia. Pero frente a esa izquierda ortodoxa ahora mismo hay micro-grupos de jóvenes activos, osados, dispuestos a renovarla, que pueden hacer de estas imágenes que vamos a exponer lugares no sólo de reconocimiento afectivo sino espacios de batalla y desobediencia simbólica. Eso le decía a Helmut cuando revisábamos sus obras guardadas en cajas en su casa en un pueblito de Essen, Alemania: “Estos materiales aún no han librado todas sus batallas, estamos en guerra y necesitamos seguir peleando. Hay que devolverlas al espacio público para que peleen con nosotros, necesitamos aliados y estas imágenes nos pueden permitir seguir soñando otra historia, seguir respirando…”. Probablemente es en ese contacto donde las chispas más interesantes salten. Nuevamente estamos hablando del Museo de Arte de Lima, ¡un espacio con un poder simbólico grandísimo! Yo no tengo dudas que van a haber ataques a la exposición y eso puede ser muy bueno. Además, que el museo coloque en vitrina estas prácticas de travestismo, mariconiza- 88 89 20. Esos dos artículos son: Luis Lama, “Perversión y complacencia,” Caretas, Lima, 20 noviembre de 1989, pp. 74-76; y Luis E. Lama, “Agtistucho,” Caretas, Lima, 19 de setiembre de 2002, p.82. 21. Véase Miguel A. López, “Queer Corpses: Grupo Chaclacayo and the Image of Death”, (ÁX[ 44 “(Im)practical (Im)possibilities” (Carlos Motta ed.), abril 2013. KWWSZZZHÁX[FRPMRXUQDO queer-corpses-grupo-chaclacayo-andthe-image-of-death/ ción del poder y denuncia homosexual de la violencia, y diga alto y claro que estas prácticas maricas VRQLPSRUWDQWHVSDUDHQWHQGHUQRV\GHÀQLUQRVFRPRVXMHWRVVRFLDOHVFRPRFROHFWLYLGDGDFWLYD\FUtWLca, es realmente decisivo. Eso no ocurre ahora mismo en ningún espacio de la institucionalidad artística en Lima. Alfredo Es interesante lo que dices Miguel. Efectivamente ese contragolpe puede permitir invertir la latencia puritana que caracteriza a los encumbrados en el poder de los espacios de gestión de las energías colectivas. Y no estoy hablando del museo sino de cómo está estructurado todo el poder nacional a nivel macro. No importa si es de derecha o izquierda, en el fondo hay esta pulsión puritana que dice que las cosas deben ser de manera normalizada, cualquier otra forma no solamente no es posible sino que tiene que ser reprimida. Señalar eso sí es muy importante porque veo al Grupo Chaclacayo como un ejercicio que vulnera todas las convenciones, y no porque ustedes estuvieran buscando no ser convencionales sino por algo más sencillo: su territorio de experiencia e intercambio afectivo fue así. Sendero Luminoso Alfredo 4XLVLHUDKDFHUXQDSUHJXQWDHVSHFtÀFD¢HQTXpPRPHQWRODOHJLWLPLGDGGHODJXHUUDGHVGH los alzados en armas es asociada al discurso visual y productivo del Grupo Chaclacayo? Sergio Es una situación rara. Te puedo contar sobre cómo se usa ese argumento, pero detrás hay mucho más. Creo que el principio es el mismo: quienes están en diferentes posiciones de poder (periodista, FUtWLFRRLQVWLWXFLyQ HVWiQEXVFDQGRODSRVLELOLGDGGHDJDUUDUQXHVWUDH[SHULHQFLD\GHVFDOLÀFDUOD(QHVH momento la guerra de Sendero era una de las maneras más poderosas de anular y destruir a cualquiera. Alfredo Y sigue siéndolo. Sergio Exactamente. A partir de ahí se han creado maneras bien perversas de destruir al prójimo. En la exposición de 1984 aún no habían encontrado nada para acusarnos, así que es recién en 1989, cuando estamos fuera del Perú, que el crítico Luis Lama escribe un artículo de tres páginas en la revista Caretas titulado “Perversión y complacencia. Estridente y frívola apología de artistas peruanos en Berlín Occidental”, algo que repite luego en un artículo de esa misma revista en 2002.20 agradecimientos a Sybilla Arredondo, quien ya estaba siendo perseguida. Allí decimos: “A Sybilla Arredondo por habernos conseguido los derechos de estos textos de Arguedas”. Y en las últimas páginas del libro está el segundo gancho, una lista que yo me encargué de realizar titulada: “Sobre violencia política ocurrida en el Perú durante el periodo que estábamos produciendo el grupo Chaclacayo”. Nosotros decidimos que sea una lista de la violencia política operada desde la institución, porque lo que nos interesaba era desarmar la legitimidad de la institución como el norte para una sociedad. Alfredo ¿Eso ustedes lo tenían así de claro? Sergio Sí, eso lo teníamos bien claro. Ahora, creo que detrás de eso hay algo que Miguel decía en un texto hace poco sobre cómo nuestra obra representaba un tipo de peligrosidad tan inmanejable que es asociada al comunismo más violento.21 Miguel Yo intentaba llamar la atención sobre el peligro que las entidades homosexuales colocan para un prototipo de cuerpo nacional limpio, sano, obediente y reproductor, que debe ser siempre heterosexual. Ese llamado al orden heterosexual es precisamente la forma en que funcionan las técnicas contemporáneas de gestión del cuerpo, exigiendo a la institución que cumpla con su papel disciplinario, y estas instituciones no son solo el museo sino también la familia, la escuela, el hospital, la prisión, la fábrica. No basta con decir que la vinculación entre el Grupo Chaclacayo y Sendero Luminoso es descabellada, para mi esa asociación es profundamente compleja porque el vínculo está en lo explosivo, en que este grupo de maricones y sus gramáticas abyectas podía ser visto tan amenazante como la violencia armada descontrolada que un grupo de maoístas estaba llevando adelante. Es interesante que la indignación que siente Lama en 1984 lo lleva a patologizar la homosexualidad, pero lo que exige en su siguiente artículo de 1989 es su exterminio: una acusación como apología a Sendero LuPLQRVRQRVLJQLÀFDEDQDGDPHQRVHQHO3HU~GRQGHSRUHVHWLSRGHLPSXWDFLRQHVWHSRGtDQVHFXHVtrar y asesinar impunemente. Pero la condena social de muerte y destrucción de los cuerpos que no condicen con la norma es más amplia, no solo es una batalla contra los cuerpos sexo-disidentes sino también contra los cuerpos repletos de piercings, las identidades-vampiro, los seropositivos, los autisWDVORVVLQSDSHOHVODVSHUVRQDVFRQGLVFDSDFLGDG«>ÀJÀJ@ Sergio Inclusive un cuerpo de mujer que no esté cumpliendo las funciones normativas que se le exigen en la sociedad, esa desobediencia es igualmente despreciada y destruida. Alfredo ¿Cuándo se van ustedes de Perú? Alfredo Claro, pero ese argumento desdice la posibilidad del vínculo con los alzados en armas, porque Sergio En enero de 1989. En síntesis: para decir que nuestra obra era una apología a Sendero Lumi- noso se usaron dos ganchos. El primero fueron los agradecimientos que hacemos en el catálogo de la exposición Todesbilder >,PiJHQHVGHOD0XHUWH@HQ$OHPDQLDHQGRQGHPHQFLRQDPRVHQORV ellos eran más puritanos que el Estado. No hay modo de que tengas una representación mariconizada en Sendero… 90 91 Sergio No, pero eso es lo interesante: en esa contradicción se hace visible que lo que estaba en juego Alfredo Sí, y por ello es que la potencia del poder simbólico es lo que está todo el tiempo sobre la era lo subversivo en sí, más allá de un programa ideológico. mesa. Nosotros no tenemos el poder de las armas ni de persuasión como sí lo tiene la coerción institucional. Solo tenemos el poder simbólico que es el territorio en el que transitamos y podemos debatir de tú a tú con cualquiera. Miguel La pregunta que yo me hacía era la siguiente: “¿a qué sujetos se le declara la guerra en esta sociedad?” Es una guerra contra un conjunto de entidades que no armonizan con los paradigmas nacional-católicos de falsa felicidad, contra los cuerpos que no son útiles para las demandas productivas del capitalismo y para la reproducción del modelo heterosexual, aun si entre esos cuerpos no existe ninguna compatibilidad como puede ocurrir entre un senderista y un maricón. La guerra está declarada contra estos cuerpos que no son absorbibles. Alfredo Estoy totalmente de acuerdo. Ese es el caso de la imagen de Mao que produce NN en 1989 >ÀJ@(VWDPDULFRQL]DFLyQGH0DRHVLQVRSRUWDEOHWDQWRSDUDODJHQWHGH6HQGHURFRPRSDUDOD gente del Estado. Y claro, sucedió que ganaron la guerra éstos y no los otros, pero yo también soy consciente que si Sendero hubiera ganado esta guerra esta representación mariconizada de Mao y otras simbolizaciones similares no iban a ser tomadas alegremente. Lo que estoy tratando de ver es si hay alguna posibilidad de encontrar en lo que conversamos algo que haga un poco más obvio cómo se ha estructurado la realidad, y estoy hablando del presente. Sergio Para hacer visibles esos nexos yo diría que es importante pensar cómo ese tipo de prácticas políticas desde el poder, el Estado y las instituciones, sigue siendo la misma. Lo que se ha inscrito a partir de los ochenta para adelante, y se ha reforzado internacionalmente a partir del atentado a las 7RUUHV*HPHODVHQ1XHYD<RUNHQHVHOPRQRSROLRPLOLWDUGHO(VWDGRFDOLÀFDQGRFXDOTXLHUFUtWLFD contra el status quoODHFRQRPtDODQDFLyQODFRQVWLWXFLyQFRQHOFDOLÀFDWLYRGHWHUURULVWD(VRVHKD convertido en una práctica usual tanto en los salones de las universidades como en la prensa amarilla, y se difunde rápidamente. Alfredo Eso exige crear otras categorías para poder discutir estos asuntos. Sergio Yo insistiría en la necesidad de acentuar que el miedo se ejerce con el poder, no se ejerce de otra manera. Si hablamos de terrorismo hablemos del Estado y de las instituciones, y las organizaciones particulares o estatales, que ejercen poder a gran escala, hablemos ahí entonces de terrorismo. A todo ORGHPiVSRGHPRVSRQHUOHRWURFDOLÀFDWLYRDPtPHJXVWDSDUWLFXODUPHQWHHOGHODLQGLVFLSOLQDSRUTXH me remite a la experiencia básica por la que pasamos todos, y es algo por lo que cualquier persona, hasta el más adaptado, el más reaccionario, puede recordar en su trayectoria entre la niñez, la infancia y el FROHJLR¢4XpVLJQLÀFDLQGLVFLSOLQD\FXiQLPSRUWDQWHIXHFRPRH[SHULHQFLDSDUDQRVRWURV"7RGRHO mundo la conoce y sabe que estaba en juego para uno mismo cuando eso ocurría. Sergio Existe este dicho que hemos visto en los colegios escrito en letras grandes que dice: “Orden es cultura”. Y es como un pensamiento institucionalmente arraigado, incluso en los sectores progresistas de izquierda, que delata una mentalidad fascista. Incluso si lo lees desde el reverso queda en evidencia: “la cultura es el orden”. Hay claramente un grupo de personas que apuesta porque la cultura sea el orden y otros quienes apostamos porque la cultura es el desorden. Entonces, cosas como las que hacía Kloaka, o lo que hacían Los Bestias con la basura, o lo que hacíamos nosotros con la sexuaOLGDGHUDQLQVRSRUWDEOHVSRUTXHHUDQXQDUHVSXHVWDDÀUPDWLYDGHOFDRVWUDEDMDGRFUHDWLYDPHQWH< lo que se expande es el miedo a ese desorden, a esa incertidumbre, a esa desorganización de las estructuras, a una gramática que no se ajusta al vocabulario político conocido, y que aparece como algo que te ensucia y te contamina. Es decir, no se percibe como algo crítico que pone en cuestión las IRUPDVWUDGLFLRQDOHVGHUHSUHVHQWDUORVFRQÁLFWRV\WDPSRFRVHSHUFLEHFRPRDOJRTXHHVWiDEULHQGR territorio para nuevos posibles, sino como algo trastornado que debe ser puesto bajo control, que debe ser disciplinado. Por eso a veces no puedo evitar pensar que las mentalidades de muchas personas de la izquierda, desde las moderadas hasta las más radicales, si es que hubiesen llegado al poder nos hubiesen reprimido igual de fuerte que cualquier otro partido de derecha. Jaime Higa (El Callao, 1960) Frido Martin (Lima, 1963) Estudió en la Facultad de Artes Plásticas de la Universidad Católica (19801984). Ha realizado escenografías para conciertos, espectáculos de danza y teatro, así como revistas independientes, libros y discos. Ha realizado 15 exposiciones individuales en distintas ciudades, y más de 150 exposiciones colectivas en ciudades como Buenos Aires, Montevideo, Los Angeles, Ciudad de México, Caracas, Barcelona, Kurosoe, Bridgport, San Antonio, entre otras. Entre sus distinciones obtenidas destaca el Primer Premio en el VI Salón Nacional de Pintura del Instituto Cultural Peruano Norteamericano (1989). Vive y trabaja en Lima. Seudónimo de Marco Antonio Young Rabines. Poeta graduado en Lingüística en la Universidad Nacional Mayor de San Marcos. Junto a Rodrigo Quijano y Fernando Bryce, fue uno de los compañeros de camino del movimiento Kloaka. En la misma época colaboró con el Grupo Chaclacayo. Autor de varios poemarios, como Naufragios (2003). En 2011 participó en un cd colectivo de poesía sonora editado por Buh Records. En el 2012, fundó con otros accionistas, músicos y poetas el colectivo de perfopoesía La Horda de la Calma. Actualmente experimenta con poesía y performance, y prepara un libro de poemas con un cd de soporte interactivo. Vive y trabaja en Lima. Alfredo Márquez (Lima, 1963) Diseñador arquitectónico, comunicador visual y operador cultural. Estudió Arquitectura y Urbanismo en la Universidad Ricardo Palma. Ha participado en los colectivos Bestiarios / Los Bestias; Taller NN; Made in Perú; Perufabrica. Su trabajo está inscrito dentro de la movida subterránea, el arte pop urbano y la contracultura limeña. Ha expuesto individual y colectivamente en el Perú y en el extranjero. Su obra forma parte de la colección del Museo de Arte de Lima, del Harvard Art Museum, de Micromuseo (“al fondo hay sitio”), entre otras colecciones. Vive y trabaja en Lima. 1 The unpublished text by Hugo Salazar del Alcazar is entitled “Chuang-Tse, Freud y el sueño peruDQRµDQGLVSXEOLVKHGIRUWKHÀUVW time in this volume (see English translation in pages 139-140). His other text is “Veleidad y demografía en el no-objetualismo peruano,” Hueso Húmero, Lima, n. 18 (June-September, 1984), pp. 112-121. 92 2 See Emilio Tarazona, “Soñando sin dormir, al ojo abierto. Una (abreviada) conversación con Helmut J. Psotta,” in ,OODSD5HYLVWDGHO,QVWLWXWRGH Investigaciones Museológicas y Artísticas de la Universidad Ricardo Palma, n. 6 (2009), pp. 85-92. The Grupo Chaclacayo A conversation between Alfredo Márquez, Frido Martin, Jaime Higa, Miguel A. López and Sergio Zevallos The beginnings Alfredo Sergio, what is Grupo Chaclacayo for you? Sergio My understanding of this has changed over the years. First of all, it’s important to explain how the name emerged. The three of us met at university: Helmut Psotta, who was a visiting professor invited by the School of Arts at WKH3RQWLÀFDO&DWKROLF8QLYHUVLW\5D~O$YHOODQHGDDQGP\self, who were students. We all had common interests in the creative, the personal and the affective. We didn’t come together simply because of art —there was a political DIÀQLW\,QDIWHUZHDOOOHIWXQLYHUVLW\ZHPRYHGLQWRD house in the Chaclacayo district where we worked for around seven years until 1989, when we left for Germany >ÀJ@$WWKHWLPHZHZHUHQ·WFRQVFLRXVRIEHLQJDJURXS SHUVH7KURXJKRXWWKHÀUVW\HDUZHKDGYLVLWVIURPYDULRXV people, one of whom was the writer and theatre critic Hugo Salazar del Alcázar. He wrote two articles where he mentioned us —one remained unpublished but the other came out in the magazine Hueso Húmero.1 He called us, ‘the group from Chaclacayo.’ This happened just a few months before the opening of our only exhibition in Lima at the Lima Museum of Art in November (1984) and we were planning the apparatus of presentation for our work. We settled on the name given to us —although not without disagreements. Helmut accepted the name immediately, Raúl also took it on but it annoyed me. I complained but quickly realized that they didn’t understand because ‘Grupo Chaclacayo’ for Helmut was an exotic name that didn’t have any connotations. )RUPHWKHUHZDVDVLJQLÀFDQWUHODWLRQWRVRFLDOVWDWXV Chaclacayo was then, and continues to be in certain sectors, an exclusive neighborhood. I felt the contradiction 3 See Miguel A. López, “Ornamentos. )ORUHV7UiÀFRVHVSXULRV-DLPH+LJD Historia invertida,” in 2UQDPHQWR -DLPH+LJD$QWRORJtDPtQLPD  2013) (Lima: Centro Cultural Ccori Wasi de la Universidad Ricardo Palma, 2013). 4 See Gustavo Buntinx, “Seducción y travestismo. Una conversación con Jaime Higa,” in 7H[WR7H[WXUD-DLPH Higa (Lima: Museo de Arte Italiano, 1990). 5 Fernando de Szyszlo (Lima, 1925) ZDVDNH\ÀJXUHLQDGYDQFLQJDEstract art in Latin America in the mid-1950s. His paintings link ancient cultures to a modernist artistic language. Szyszlo studied at the School but they didn’t read it like that so in the end it stuck. 7KHVHFRQGWKLQJWRPDNHFOHDULVWKDWDIWHUWKHJURXSÀQished in 1995, each one constructed their own reading of what the group was and what it meant. Obviously there are different interpretations. In the case of Helmut, I think he observed the project from a very individual perspective, as if it was his particular project— he says this in an interview with Emilio Tarazona in 2009.2 When we were working and producing together there was never this vertical relationship. There was a difference because Helmut had more experience and was older, but when it comes down to the concepts and the ideas produced the situation was quite horizontal. He subsequently began to talk about Grupo Chaclacayo as a personal product, which is not the way WKLQJVDFWXDOO\ZHUH,QP\VXEVHTXHQWUHÁHFWLRQV,·YH managed to think about it from an inverted position: rather than a delimited group I see it more as a micro-movement. Not a big movement that occurs in societies, but a micro-movement. If there was a nucleus of three people and we sustained the work full-time, it goes without saying that there must have been other people who participated continually in actions and projects. I don’t think Grupo Chaclacayo has precise borders but rather it’s a transit zone. Here in Lima there were three very active people— Frido Martin, Sixto Paniora and Jorge Ángeles. Their distinct personalities and characters all contributed to the work. Sixto is from Abancay and had a big corporality— a kind of rugged handsomeness. Ángeles on the other hand was the son of a woman from the Amazon and I think he never met his father. From his appearance alone he could have been a foreign tourist. There was also a German artist Klaus Wittkamp who visited us twice in Lima and participated actively in the performances in Germany. The character of each one ended up modifying the works to the point that if one of them couldn’t come, the work was not going to be the same. Many actions and works were formulated through the conditions and characteristics of these people as well as our own. I see Grupo Chaclacayo in this way: as DVXPRIWKHSDUWVRIDOORIWKHSHRSOHDIÀOLDWHGZLWKWKH work even if this was sporadic. The density and strength of everything that was made is the result of this collision —this collective interaction. Jaime I wanted to talk about the work you made during university. Particularly those exercises that Helmut was doing that I call ‘psychic automatism’: exercises that use ac- of Plastic Arts of the Catholic University in Lima, where he taught for several years. He is a very wellNQRZQSXEOLFÀJXUHLQ3HUX6LQFH 1960s Szyszlo maintained a conservative position regarding experimental practices beyond traditional art disciplines. 6 General Velasco seized power on October 3, 1968 in a bloodless military coup, deposing the democratically-elected administration of Fernando Belaúnde, under which he served as Commander of the Armed Forces. General Velasco ruled Peru as dictator from 1968 to 1975, under the title of “President of the Revolutionary Government.” General Francisco Morales Bermúdez overthrew him in 1975. After a series of strikes and mobilizations in 1977 the government decided to hold elections for the Constitutive Assembly that was introduced in 1978. The following year they re-worked the constitution, which sanctioned general elections to elect a new President of the Republic. The day of the elections (18 May, 1980), the Communist Party of Peru —Sendero /XPLQRVR>6KLQLQJ3DWK@³GHFODUHGD war on the State, burning ballot boxes in the district of Chuschi in Ayacucho. cumulation and graphic sign-making in order to extract images from the unconscious.3 I see echoes of surrealism KHUH³ZKHUHWKURXJKIUHHDVVRFLDWLRQLW·VSRVVLEOHWRÀQG new representations. I think this method was important for the processes of ‘intimate exploration’ that you later GHYHORSHGDVDJURXS,UHPHPEHU5D~ODQG6HUJLR·VÀUVW works and they were very different to the more powerful works made in the Chaclacayo house. Sergio There are two matters here and I will respond to them in different ways. Firstly concerning the method: Helmut already had various methodologies for working because he was coming from an established pedagogical experience in Holland and Germany and even the Catholic University of Chile in the mid-sixties. He developed exerciVHVWKDWZHUHUHÀQHGRYHUWKH\HDUV7KHWUDQVPLVVLRQ of this methodology was really important. But I wouldn’t QHFHVVDULO\GHÀQHLWDVGHULYLQJIURP6XUUHDOLVP,VHH these experiences in a non-programmatic way —if there was a link with Surrealism that later became mixed and LQÁXHQFHGE\VRPDQ\RWKHUWKLQJVWKDWFDPHVWUDLJKWIURP Helmut. He always transformed things in his own way. I would connect this with the second question: the work that we made was based on a meeting of subjects with evident DIÀQLWLHV,WZDVFOHDUWKDW5D~ODQG,ZHUHZLOOLQJWRZRUN on certain subjects openly. Placing the theme of sexuality in the foreground of the work was what most intensely bound us together. So when Helmut began to work with XVDQGLQÁXHQFHXV³WKLVRFFXUUHGZLWKLQWKHEURDGHU frame of trust, interests and shared risks. I wouldn’t say that it was the games of free association that allowed us to develop processes of ‘intimate exploration’ but, on the contrary, we already knew where we wanted to go. It was SUREDEO\WKHVHJDPHVWKDWPDGHWKHVSDUNVÁ\EXWZH were already deep in. I don’t know which works you are familiar with but I wouldn’t take into account those that we made at university. I have a small collection of things that I made with Raúl before we met Helmut where there were already images of transvestism and registers of the body. While sexuality was close to the surface for us both, ZHGLGQ·W\HWKDYHWKHVXIÀFLHQWWRROVLQRUGHUWRYLVXDOO\ formalize these themes in a powerful and articulated way. That followed as a result of the encounter with Helmut. I would also say that Helmut’s artistic language was particularly cryptic before he met us and this changed as a result of our meeting. 7 The Colonia Penal Agrícola del Sepa (commonly referred to as El Sepa) was a wall-less penitentiary located in a region of the amazon jungle considered to be highly isolated. It functioned between 1951 and 1993. Currently, the building has been converted into a livestock center owned by the National Penitentiary. 8 The magazine Sociedad y Política was founded and directed by Aníbal Quijano between 1972 and 1983. The editorial board consisted of Heraclio Bonilla, Julio Cotler, César Germaná, Rodrigo Montoya, Felipe Portocarrero, Ernesto Yépez and Abraham Zevallos, amoung others. The magazine had developed a social Marxist analysis critiquing the military government -causing the deportation of Quijano and Cotler. They also consistently develRSHGUHÁHFWLRQVDERXW/DWLQ$PHULFD and became one of the most advanced publications on the continent. 9 In Peruvian slang ‘pituco’ is a term that can be used in a critical, ironic or disrespectful way to refer to people who seem to come from comfortable backgrounds (middle or upper classes). 10 The Spanish neologism ‘deshechos’ in the title Deshechos in Arquitectura is a pun, on one hand Alfredo 7KLVIUHHÁRZRILGHDVLVLQWHUHVWLQJ7KHFRQQHFtion between Helmut, Raúl and you that produced the Chaclacayo ‘situation’ is actually complex because whether you like it or not there was a level of subordination: you were both students of a professor and you were all operating within the institution of the Catholic University. You belonged to a program that was geared towards the Austrian romantic paradigm of Adolfo Winternitz, who created the school of art. So I have to ask myself: what was it that produced this situation? What you did as a group was exceptional —it made visible many social contradictions and seemed to have no relation with what came before or what would come after. Sergio What was it that produced all of this? In a word: intimacy. When you create a relation of intimacy with someone you generate a different space, another dimension of what is possible. If you don’t create this intimate relation then the space is not generated and the dimension RIWKHSRVVLEOHUHPDLQVFRQÀQHGWRWKHSDUDPHWHUV\RX give. We generated a lot of intimacy, above all at the beginning. Helmut had a sexual relationship with me and with Raúl. There was a transfer of experience and of being together that was distinct from what he could have had with other people in those years. If you have a teacher-student relationship what you have is a link constructed in the classroom. If you develop a friendship your rate of transfer is different. It was about exploring the various degrees and ways in which a body enters into relationship with another body. The story was changing radically not only for us but for Helmut: suddenly he was emotionally involved with two people in the ass of the world as seen from Europe. This implied changing his life plans: we stayed in Lima for seven years! Suddenly this peripheral city became his new center and his place of origin became the ass of the world. There ZDVDQLQYHUVLRQIURPRQHH[WUHPHWRWKHRWKHU>ÀJ@ Jaime Helmut had a relationship with you and with Raúl but you never had relations with Raúl? Sergio Yes, before that. We had already had a relationship. What happened was that Helmut arrived to the university and spent much more time with the freshmen —his work contract was directed towards that until they began to load him with more courses. With my class he only gave a short course. Helmut met Raúl and me later after having 94 alluding to the literary translation of “desechos” as garbage or waste (Waste in Architecture), and on the other, referring to “des-hechos” as the act of reversing or annulling something and/or bringing to destruction (Undoing in Architecture). 11 For a chronicle of Los Bestias, see Elio Martuccelli, “La arquitectura y el desborde urbano,” in Arquitectura para una ciudad IUDJPHQWDGD,GHDVSUR\HFWRV\ HGLÀFLRVHQOD/LPDGHO6LJOR;; (Lima: Universidad Ricardo Palma, 2000). 12 On the experience of E.P.S Huayco, see Gustavo Buntinx, met lots of other people, but it was with us that he felt the sense of intimacy that would develop intensely. In the case of Raúl and I: we met just as I arrived. In university there was always a circulation of affective and sexual relationships, a sense of ‘everybody with everybody.’ There were more reckless generations and others that were TXLHWHU,ZDVSDUWRIWKHÀUVWJHQHUDWLRQRIWKHIRUPDO VWXG\RIÀQHDUWV²LWFKDQJHGIURPWKH6FKRRORI$UWWR Faculty of Arts. That was when the university began to demand a minimum of sixty or seventy students in a class, which brought about a change in terms of the dynamic. Perhaps when the group was smaller the relations of LQWLPDF\ZHUHVLPSOHU>ÀJ@ Miguel$QGZKDWZDVWKHUHODWLRQ-DLPH>+LJD@WKDW\RX had with Helmut? In an old interview you explained that the encounter was the most important moment for you in university and other artists like Fernando Bryce have pointed out that if there were any important memories from his time at university it was precisely the encounter with Helmut.4 Jaime 0\ÀUVWFRQWDFWZLWK+HOPXWZDVZKHQ,ZDV making a series of paintings with black and white stains. During this time I was always stoned in the classroom because I found it so awkward to paint with other people around. I don’t know if I’d smoked that day but I remember that Helmut walked into the classroom, saw the work I was doing and said in a reproachfully tone: “What are doing here?” (Laughter). He would walk around the class, looking and complaining. Everything seemed bland to him. As a student, I thought his methods were interesting. Many of the students didn’t like it as they felt questioned, exposed— things came out that they didn’t want other people to see. For others his methods were absurd: “What is this trash?” (Laughter). But everything came to an end abruptly because of the problems that started with Winternitz who strongly disagreed with Helmut regarding the topic of torture. Sergio Exactly. I remember that they asked him to give a short course for junior year sculpture students. When he arrived to the classroom he said: “We’re going to do a seminar. Theme: torture.” It was very direct. We’d already been talking about how the university, especially the school of art, was like an ivory tower where everything going on ed. (36+XD\FR'RFXPHQWRV (Lima: CCE, MALI, IFEA, 2005). 13 NarcosisZDVRQHRIWKHÀUVWORFDO rock bands. Their only disc Primera Dosis>)LUVW'RVH@ZDVRQHRIWKH emblematic recordings of the underground scene. See Carlos Torres Rotondo, 6HDFDEyHOVKRZ (OHVWDOOLGRGHOURFNVXEWHUUiQHR (Lima: Editorial Mutante, 2012). 14 On sending the work of NN to the Third Havana Biennial in 1989, see Miguel A. López, “Revolución Cultural y Orgía Creativa: El Taller NN (1988-1991). Entrevista con Alfredo Marquez,” in ,OODSD5HYLVWD del Instituto de Investigaciónes Museológicas y Artísticas de la Universidad Ricardo Palma, n.8, (2011) pp. 42-58. See also Rachel Weiss et al., 0DNLQJ$UW*OREDO 3DUW  7KH7KLUG+DYDQD%LHQQLDO (London: Afterall, Academy of Fine Arts Vienna and Van Abbemuseum, 2011). 15 On .ORDND, see Juan Zevallos Aguilar, .ORDNDDxRVGHVSXpV MK (1982-1984): Cultura juvenil urbana en la postmodernidad periférica (Lima: Editorial Ojo de Agua, 2002); and José Antonio Mazzoti, 3RpWLFDVGHO)OXMR0LJUDFLyQ\ violencia verbales en el Perú de los 80 (Lima: Fondo Editorial del Congreso del Peru, 2002). outside was avoided. Evidently a lot of people didn’t like the topic. Helmut told us when Winternitz heard about it WKHUHZHUHÀJKWVEHWZHHQWKHP2QHWLPH:LQWHUQLW]IRXQG him on campus and seriously reproached him; “Why torture? Is there torture right here? Perhaps you have seen a tortured person walking down the street?” Jaime At the same time, a series of rumors started going around that before coming to Lima Helmut had problems with the university where he taught in Chile. Some said, “This teacher has come to stir things up.” Then Helmut left the college, as did Sergio and Raúl. The next time I saw them was when they exhibited at the Museum of Art two years later, towards the end of 1984. I really think the university changed when Helmut was there —it was a jolt. Without this shift lots of us would have ended up painting OLNH)HUQDQGRGH6]\V]OR ODXJKWHU >ÀJ@5 Sergio Yes. I don’t think it was a coincidence that many of us decided to leave university. Helmut’s methods were so unexpected and new that after his departure the university closed in on itself so that future generations wouldn’t HYHQÀQGDWUDFHRIKLP7KHUHZDVDGLVFRQWLQXLW\³WKH experience he left was in the people that later dispersed or left the school. Those that stayed or returned to university as teachers were not the ones who had metabolized the experience. The political and cultural context Alfredo In the late seventies the military government of 9HODVFRKDGÀQLVKHGDQGWKHHOHFWLRQVEURXJKWWKH EHJLQQLQJRIWKHLQWHUQDODUPHGFRQÁLFWLQ3HUX6 How did this affect the Chaclacayo ‘situation’? Or were the LQWHUSHUVRQDODQGDIIHFWLYHWLHVWKHRQO\UHDOLQÁXHQFH" Sergio %RWKGLPHQVLRQVZHUHLQÁXHQWLDODQGWKH\ZHUH always connected. I have highlighted the question of personal relations, however I want to make clear that I’m not romanticizing them. What I’m saying is that from my perspective, it is through the affective relations that everything is generated. But obviously this isn’t a hero cult. Alfredo I’ll extend the context of my question: you are art VWXGHQWVDQLQWHUQDODUPHGFRQÁLFWEHJLQVDQG\RXOHDYH Lima to develop a project that lasts seven years. From this 16 See Roger Santibáñez, “Música joven: entre la chicha y el rock,” Revista de la Semana 18, suplement of El Observador (Lima, 3 April, 1983). 17 Alberto Fujimori, elected presiGHQWRI3HUXLQÁHGWR-DSDQ amid corruption charges in 2000, bringing his ten-year authoritarian administration to an abrupt end –it was the broadcast footage of government authorities bribing poOLWLFLDQVRIÀFLDOVDQG79VWDWLRQV· chiefs, that led to the fall of the dictatorship in Peru. During his government, Fujimori enacted wide-ranging neoliberal reforms and launched a widespread and systematic cam- paign of torture, disappearance and extrajudicial execution against opposition leaders, students and union organizations, left-wing intellectuals, in the frame of the low-intensity warfare to defeat Shining Path and MRTA. Fujimori was arrested in Chile in 2005 and later sentenced to WZHQW\ÀYH\HDUVLQSULVRQIRUKXPDQ rights violations, embezzlement, and bribery. He still enjoys a measure of popular support. 18 The exhibition Perder la Forma +XPDQD8QDLPDJHQVtVPLFDGHORV años 80 en América Latina [Loosing Human Form. A Seismic Image of WKHVLQ/DWLQ$PHULFD@ZDVD curatorial and research project coor- experience the only public trace is the show at the Museum of Art in 1984. This exhibition was like an explosion; it was like a meteorite that burst into the center of the symbolic order of art. The shrapnel from this explosion remains today —you can count among the dead and injured yourselves as well as others. This exhibition had a latency that unraveled over time. However, your previous experience is much longer and have various origins and outcomes. Sergio How did this Chaclacayo ‘situation’ occur and why do I say that relations are the moment when something, whatever it is, emerges? I’ll do a bit of pre-history and go through some personal memories. I come from a politicized family. My father Abraham Zevallos had already been in jail as a political prisoner a few times. He had been in El Sepa de la Selva7 and he produced a magazine with Aníbal Quijano, César Germaná, Felipe Portocarrero and other friends. The magazine attacked Velasco during the military regime so they deported Aníbal and other people. Alfredo What’s the name of the magazine? Sergio Sociedad y Política>6RFLHW\DQG3ROLWLFV@8 At this time, my father didn’t appear as editor of the magazine, but only as a person in charge of tasks of practical production and that was what saved him from deportation. This LVDÀUVWFRQWH[W$VHFRQGFRQWH[WZRXOGEHZKHQ,HQWHUHG puberty and my time at school. I left the private school where I was studying because my parents couldn’t afford to continue paying the fees so they moved me to the national state college Melitón Carvajal. Alfredo That’s where I studied! So you were a ‘pituquillo’ >DSRVKNLG@DQGVXGGHQO\\RXODQGHGDW0HOLWyQ&DUYDMDO (laughter) And what happened? Sergio In Melitón Carvajal my experience was characterized by teenage violence: beatings, sexual harassment and these kinds of things. But the decisive moment was the process that unfolded around the strike of 1977 and the long strike of SUTEP. We all participated. We encouraged the teachers, assistants and everyone. This accumulation of events produces a particular type of subjectivity. Raúl comes from a wealthy Lima family who were super catholic. +LVPRWKHULVSXUHSLWXFD>SRVK@9 and his dad was a typical landowner. When his mother was pregnant in Huancayo dinated by Red Conceptualismos del 6XUDQGSURGXFHGE\WKH5HLQD6RÀD National Museum of Art in Madrid, Spain. The exhibition presented a revision of the eighties and established a relationship between the effects of the violence on the body and the radical experiences of freedom and social transformation that disobeyed the repressive regimes. This exhibition and Un Cuerpo $PEXODQWH6HUJLR=HYDOORVHQHO Grupo Chaclacayo, 1982-1994 were presented simultaneously in Art Museum of Lima. See Red Conceptualismos del Sur, Perder la Forma +XPDQD8QDLPDJHQVtVPLFDGHORV años 80 en América Latina (Madrid: MNCARS, 2012). 19 In a lengthy article on Chaclacayo Group in 1983, Gustavo Buntinx EULHÁ\FRPSDUHVWKHFRXUVHRIFROOHFtive E.P.S. Huayco -dissolved shortly before- with Chaclacayo Group work. Buntinx notes their differences not only in aesthetic terms but in relation to the social dynamics of artistic production from which each is positioned. For Buntinx, a major difference lies in the dialogue proposed by the E.P.S. Group Huayco with popular classes codes, unlike Chaclacayo Group which opts for a withdrawal of the scene that does not allow its members to network with other creative and political processes. See 6HEDVWLDQ*ULV>*XVWDYR%XQWLQ[@ they came to Lima so that Raúl would be born there and QRWEHD¶KXDQFDtQR·>DSHUVRQIURP+XDQFD\R@+LVPRWKHU died young and Raúl was brought up by a domestic worker from the Sierra. In the end his mother was more ‘huancaína’ than his birth mother. Raúl would always carry the PHPRU\RIKLVIDWKHUEHLQJDQDEXVLYHPDÀDJX\OLNHD character from the novels of Arguedas. Throughout adolescence he started exploring processes of reinterpreting his sexuality, looking for affection and exchanges with strangers. These were the two historical structures that entered the group with us. Obviously if you dig a little deeper you realize that these experiences are framed by profoundly historical questions about Peru: how the country is constructed through a colonial complex that divides the coast IURPWKHUHVWRIWKHFRXQWU\DFDWKROLFFRPSOH[WKDWGHÀ nes the possibilities of your sex life as well as the abysmal class divide. So on one side we had Raúl who rebelled against his protective macho father and on the other side someone who saw his father criminalized for political activity and being disruptive. This convergence of experiences that run through Peruvian history would then collide with a Jewish person who was born in Germany in 1937 and who was saved from being murdered during the Second World War. Jaime Helmut also worked a lot with the memory of his mother… Sergio Exactly. Helmut’s father converted to Christianity DQGEHFDPHDIÀOLDWHGZLWK1DWLRQDO6RFLDOLVP+LVPRWKHU who was Jewish, had to separate from his father. Not a divorce but a distancing. His mother brought him to a non-Jewish family to look after him and she saved his life. Evidently she wasn’t able to escape with her son. Helmut never found out what happened to her or how she managed to survive during the Second World War. Afterwards they found each other again but she wouldn’t tell him what happened. We are three people that grew up on the crux RIYHU\LQWHQVHSROLWLFDOFRQÁLFWV²GLIIHUHQWFRQÁLFWVEXW in a way similar to each other. I think that is why this triple crash had such a particular density in terms of an intentionally aggressive aesthetic. I also think that these experiHQFHVWKDWZHUHVRGLIÀFXOWPDGHXVIHHOYXOQHUDEOHRU unskilled in social relations and maybe that helped us to close in on ourselves. 96 “Una experiencia extrema en nuestro arte” [An Extreme Experience in 2XU$UW@LQEl Caballo Rojo, Lima, 28 August 1983, pp.10-11. For the text referred to the exhibition at the Museum of Art, see Sebastián Gris >*XVWDYR%XQWLQ[@´*UXSR Chaclacayo. Los cuerpos del delito” >*UXSR&KDFODFD\R&RUSXV'HOLFWL@ in La Republica, Lima, 9 December, 1984, p. 49. On the deep research of Buntinx on the group E.P.S. Huayco, see reference in footnote 12. 20 Luis Lama, “Pobre Goethe,” Caretas, Lima, 3 December, 1984, p. 63. 21 On the 11 October, 2013 the president of Ecuador Rafael Correa threatened to resign if the legislative Alfredo I was going to go there. There are a number of features that are particular to the Chaclacayo community. You visualize the absolute intimate, which manages to retain its intimacy even in its public exteriority. Sergio It is a great shame that we never met you [referring WR$OIUHGR0iUTXH]@DV\RXZHUHDOUHDG\GRLQJVLPLODUVWXII Alfredo But we met you guys through the exhibition you did at the Museum! At that moment I was part of the group /RV%HVWLDV«>ÀJ@ Sergio Yes but I’m referring to the fact that we never made a strong link directly or produced work together. Retrospectively, I realize that we missed an opportunity that may have provoked the expansion of this micro-movement. Alfredo I wanted to say the same but the other way around. Los Bestias were producing a project called Deshechos en arquitectura (1984).10 It was an intervention onto the uniYHUVLW\FDPSXVZLWKFRQVWUXFWLRQVPDGHIURPWUDVK>ÀJ @11 I remember that Herbert Rodriguez arrived one day and said, “There’s a collective that has a show in the Museum of Art which we’re going to see.” And when we went we discovered that you guys were like our brothers —it was the aesthetic of the material, the precarity and the exhibition of the body. But you were a million times more political than us! This use of the body as a vehicle that powerfully interpolates social constructions was just too much for us! The level of politicization that you proposed was coming from a radical position that was almost unbearable. However, the idea of working from the edge, from the vulnerable, IURPUHVLJQLÀHGZDVWH³WKDWZDVZKDWFRQQHFWHGXVZLWK you without ever having met face to face. It was Herbert that made this connection that was totally unexpected and VXGGHQIRUXV>ÀJ@ Jaime Herbert knew Raúl really well. They met at university where they were a year apart. Alfredo I didn’t know that. I’m going to dare to say the IROORZLQJWKH\DOZD\VWDONDERXWWKHLQÁXHQFHRIWKHZRUN of E.P.S Huayco (1980-1981) for all the radical art of the eighties.12%XWZH>/RV%HVWLDV@QHYHUNQHZ about Huayco —we never saw any of their stuff. It was Herbert that had been a part of it and came to us with stories initiative tto decriminalize abortion (put forward by ministers on his own parliamentary bench) continued to advance. He publicly accused those who proposed it as ‘disloyal’ to the party and country. The threat caused the removal of the proposal from Parliament, which in turn provoked a powerful reaction from feminis groups and organizations for the defense of sexual and reproductive rights. 23 See Miguel López, “Queer Corpses: Grupo Chaclacayo and the Image of Death” in (ÁX[¶ ,P SUDFWLFDO (Im)possibilities, ed. Carlos Motta, April, 2013, KWWSZZZHÁX[FRP journal/queer-corpses-grupochaclacayo-and-the-image-of-death/) 97 22 See Luis Lama, “Perversión y complacencia,” in Caretas, Lima, 20 November 1989, pp.74-76; and Luis Lama, “Agtistucho” in Caretas, Lima, 19 September 2002, p.82. DQGVKRZHGXVWKHLPDJHV>ÀJ@7KHSHRSOHWKDWZHGLG share something with, but whom we had never met personally, were you —through the exhibition in the museum! This presence was really important for us. It could have been PRUHLQÁXHQWLDOEXW\RXGLVDSSHDUHGZLWKRXWDWUDFH$QG our world was never really the art world —we were architects. Sergio Yes. After showing to the public our work we missed the opportunity to connect with the local scene in Lima. And that has a lot to do with our behavior, which was also one of Helmut’s strategies that looked towards creating a space of independence and distance from our immediate environment. He thought that if we maintained a certain distance we would arrive much further in our exploration. And it worked, but it also created some problematic dynamics —in particular the construction of a structure so entirely closed in on itself that it prevented the possibilities to expand and mix with other things. We became an entity that had to be protected and cared for —it was like we were scared of being contaminated by others. Alfredo It’s ironic that the group and your work were so hyper contaminated and yet the structure of the group wouldn’t allow for the possibility of contamination. ings?” (Laughter). So I started hanging out with friends who I used to exchange records with. In the beginning it was prog music. What was happening with institutionality was a shift in positions: black or white, good or bad, living or dead and nothing more. Alfredo We all listened to prog rock! Jaime It’s strange that in the newspapers there were so many headlines describing the violence and death and yet people couldn’t accept symbolic or artistic representations WKDWDOOXGHGWRZKDWZDVKDSSHQLQJ>ÀJÀJ@6RWKH underground concerts were censored. When Narcosis played Sucio policía>'LUW\3ROLFH@LQDIHVWLYDOWKHSROLFH shot into the air and every dispersed. Jaime I remember once I went to Martín Berninzon’s house and discovered Bowie when he played with Brian Eno. Later I started to listen to The Sex Pistols, and it seemed like a natural transition. Suddenly after leaving university I realized that the friends who I used to share records with were starting to form their own bands. One day I go to Wicho Garcia’s house and he says, “Cachorro >)HUQDQGR9LDO@DVNHGPHWRVLQJLQKLVEDQGZKDWVKRXOG I do?” So I asked him, “Have you got anything else to do?” “No!” “Well, do it then!” So he did it. Alfredo With Narcosis>ÀJ@13 Jaime Exactly. At that time Cachorro had an incredible energy. He was pure do it yourself —most of the stuff we did, we did because of his enthusiasm. Miguel Did you have any idea of what was beginning to emerge at the margins of the dominant cultural scene? I’m referring to the underground music scene, the graphics DQGSXEOLFDWLRQVWKDW-DLPH>+LJD@DQGPDQ\RWKHUVZHUH producing, or the recitals and radical poetry of Kloaka that )ULGR>0DUWLQ@SDUWLFLSDWHGLQRUWKHÀUVW%HVWLDULRV Sergio It’s interesting that you mention the killing of El Sexto. All of the newspapers and mass media that acknowledged these killings were important for us as well. We were already accumulating material —we had collected an enormous pile of La República, El Diario, Amauta and others. If we had a certain ‘blindness’ towards what was going on in the cultural scene, we were totally tuned in to what was happening across political visually. This was material you were using as well. Sergio No. We had no link with these other things —perhaps vague references but without a connection. Jaime Yes of course, it was the same source of information. Alfredo You were living in your monastery gobbling yourself up! (Laughter) Sergio It was because of the media imagery and television that our work could be so close without ever having met each other. It was a shared experience. But I wouldn’t say WKDWWKLVVLJQLÀHGWKHGLVVROXWLRQRI¶LQVWLWXWLRQDOLW\·,WZDV rather that a fascist state was beginning to emerge and it was preparing for a war. It was probably more that we were dreaming about the dissolution of the institutional context or trying to dissolve it through dismantling the visual and the aural and creating products that escape the authoritarian logic. We were trying to destroy the institutional logic. Jaime That year various things began to happen. We watched the killing of El Sexto in prison in March 1984 on TV. Those things started to tell us that the institution was dissolving. These kinds of images made us advance faster, desperately even. I left the Catholic University beFDXVH,WKRXJKW´)XFNLIWKH\DUHÀQGLQJPDVVJUDYHVDQG bombs are falling everywhere, who is going to buy paint- Sergio Right. It’s important to remember the circumstances in Lima when we consider what you could or couldn’t make, above all with respect to the concerts, performances, interventions, which are situations where one is exposed. In this context we were lucky to be able to do that exhibition in the museum. The exhibition in the Museum of Art Alfredo Yes. It’s as if it doesn’t correspond. You [referring WR-DLPHDQG)ULGR@ZHUHWKHLUFODVVPDWHVDWXQLYHUVLW\ and later these guys left the college to go with Helmut and suddenly these dissidents have a huge show at the Lima Museum of Art. How should that be processed? Isn’t it strange? Jaime Sure, but most of us were already tuned in to what they were doing in the Chaclacayo house. Frido Of course it was surprising. Not only because they were young and they were producing at the margins like us but because they proposed an experience that was so visFHUDOLQDVSDFHDVRIÀFLDORULQVWLWXWLRQDODVWKH0XVHXP of Art. Alfredo I was studying architecture and if I’m honest I would say we didn’t care about whether what we did was labeled art or not. We didn’t give a shit about art! We were interested in physical actions and the body producing symbolic representations in space that modify productive and affective relations. So for us the exhibition was an amazing discovery. But we never imagined the magnitude of what it meant for our colleagues in the art world. Sergio, what was it that allowed for this to happen? This question 98 is interesting. I’ll tell you something from my own background: later when Los Bestias collective dissolved, a couple of us organized ourselves and formed the Taller NN in 1988. Suddenly the following year the NN is invited to the Third Havana Biennial. The whole art scene in Lima was asking, “who are these guys?” They literally said “they’ve gone to this important art event to represent Peru without knowing how to read or write.” What happened in RXUFDVHLVWKDWWKH¶DVWHURLG·>&XEDQDUWFULWLFDQGFXUDWRU@ Gerado Mosquera crossed our path as he was interested in our production.14 But there was nothing in the trajectory of our work that could have been displayed in the context of an international art exhibition. Sergio In our case there was a political opportunism that Helmut knew how to take advantage of. Alfredo An opportunism of whom? Sergio Of those in the position of authority in the Museum of Art. The museum is different now to what it was back WKHQ³LQIDFWWKHFRQÀJXUDWLRQRIWKHVSDFHZDVWRWDOO\GLVtinct. The mayor at the time, Eduardo Orrego, had an idea to renovate the museum dramatically. It just so happened that the Museum had heard that an important German critic was interested in a building designed by Eiffel: the Palace of Exhibition where the Museum of Art is located. They managed to bring him to Lima to a small seminar with people interested. The name of the critic was Wieland Schmied who was the director of the DAAD (a German program for academic exchanges). He would later become the director of the academy in Munich. Helmut also heard about the visit of the critic through the Goethe Institute of Lima and he asked the director to send information about the work that we were doing in Chaclacayo. Wieland decided to visit us and he was fascinated by our project. His interest was genuine and he even wrote something for the catalogue. The council, (with Orrego at the head and Miró Quesada on the board of trustees of the Museum of Art) were speculating about the possible investment of millions coming from Germany that would go towards the renovation of the museum. They’d proposed an architectural re-design of El Parque de la Exposicion [the Great Park of Lima and the Palace of the Exhibition where is situated the 0XVHXPRI$UW@DQGWKHWRZQKDOO%XWWKHRQO\FRQWDFWWKH\ had was Mr. Schmied. Helmut and Wieland spoke about 99 this and were very conscious of how local politics works. They saw the possibilities for corruption that lay behind the big project. So Wieland distanced himself from them and from the possibility of being used to bring in the money. But because he remained fascinated with us he decided to play a card: he told the board that we were the best he had seen in local contemporary artistic production. So Mr. Miró Quesada sent a letter to the director of the museum, Felipe Ontiveros, advising him to visit us and see our work. He has actually told me exactly what happened when he went to the meeting: “Sir, I would like to report about what’s going on in the Chaclacayo house…” and he responded simply: “Do an exhibition.” And Ontiveros replied “Yes, but…” “Do the exhibition!” “But I think you should look at…” “Do the exhibition!” (laughter). And the exhibition was done! exposed again. It wasn’t only about erasing what Grupo Chaclacayo did but also the traces you left behind in the bodies of those who witnessed it. After you, nothing had the same level of laceration and simultaneous perversion that you deployed in your work. Alfredo This is what history is made of! This is really important because you can see how the power brokers move behind the scene. Having the kind of public presence that you had was only possible because of the politics behind it. Sergio It’s no coincidence that many of the countercultural initiatives that we’ve been talking about still haven’t been VXIÀFLHQWO\XQGHUVWRRGRUSROLWLFDOO\SURFHVVHG,UHIHUWR the underground scene: the work of Los Bestias, the experiments of Herbert Rodriguez in the Carpa Teatro, Taller NN’s graphic work, the queer theater of Teatro del 6RO«>ÀJ@ Sergio Of course. When you realize that’s what is going on you have to get your foot straight in the door. That was EDVLFDOO\ZKDWKDSSHQHG³LWZDVDÁHHWLQJPRPHQW Sergio That’s how society works. We thought that the level of destructiveness that the state apparatus had is illuminating. The political euphoria that came after the 1977 strike became disarticulated after the event. How can a society that had such an intense level of politicization and willingness to organize produce the social entity that we see and experience today, which is so completely depoliticized and atomized? Counter-memories of the eighties Frido Or what Kloaka were doing. Alfredo You managed to take advantage of that moment to gain a lot of visibility. But then you got punished for daring. That punishment has hung over the memory of the Chaclacayo collective until today. That’s why the exhibition that you’re organizing with Miguel is really important: not to avenge the memory but to be able to think about the level of disobedience that the group brought to the table. I’m sure other things will come out of this project too. Alfredo Exactly. The peak of this cultural moment was around 1984. This year coincided with Grupo Chaclacayo’s H[KLELWLRQDWWKH0XVHXPRI$UWZH>/RV%HVWLDV@VWDUWHG to make Deshechos en arquitecturaDQGRUJDQL]HWKHÀUVW Bestiarios that weaved together articulations between URFNWKHDWUHÀQHDUWVDQGLWZDVDOVRDQLQWHQVHPRPHQW for Kloaka. Sergio Of course. In fact, after the exhibition in 1984 there was a kind of tacit consensus that nothing like that could or would ever happen in the museum again. Sergio Frido, when you came to visit us and participate in some of the actions, were you already working in parallel with Kloaka? Alfredo “We’re never having this shit again, nor any other kind of shit that looks like this.” In those days there was no equivalent of today’s Cardenal Juan Luis Cipriani (someone who embodies all the dark, violent, and manipulative dimensions of power). But there were lots of powerful people who were very committed to building something that would prevent this level of disobedience from being publicly Frido <HV,ÀUVWPHW-RVp$QWRQLR0D]]RWWLDQG(GXDUGR Chirinos at the Catholic University. Through Mazzotti I met Roger Santiváñez, who was close with the collective E.P.S Huayco (1980-1981). The painter Enrique Polanco, who SDUWLFLSDWHGLQWKHGHVLJQRI.ORDND·VSRVWHUVDQGÁ\HUV ZDVDOVRFORVHZLWK+XD\FR>ÀJ@15 I wasn’t formally part RI.ORDNDEXWWKHUHZDVDVWURQJDIÀQLW\EHWZHHQXVDQG, participated in the events that they did. Around the same WLPH,PHW6HUJLR5D~ODQG+HOPXW0\ÀUVWHQFRXQWHUZLWK \RX>UHIHUULQJWR6HUJLR@ZDVLQFROOHJHVWXG\LQJOLWHUDWXUH, loved passing by the art faculty to see what they were up to and one day I ran into Raúl and Sergio and we started talking. After a few days I realized that the sculpture you were working on was what we were going to take out around the university in the procession. I remember that \RX>6HUJLR@VDLGWRPH´+H\)ULGRZKDWDUH\RXORRNLQJ DW"+HOSPHÀQLVKWKLVµ)HUQDQGR%U\FHZDVDURXQGWRR³ I’d met him already because he was in a band with poet Rodrigo Quijano called Durazno Sangrando [Bleeding 3HDFK@>ÀJ@16 I didn’t have much contact with the visuDODUWVDWWKDWWLPHEXWP\DIÀQLW\ZLWK\RXWKUHHZDVLPPHdiate. Huayco’s work was interesting but I saw something particularly powerful in your work, which connected with my search for ways to relate the literary, the visual, the aural and the corporal. At this point I was completely devoted to poetry. My referents were the surrealists and that whole VFHQHDWWKHHQGRIWKHVL[WLHVLQÁXHQFHGE\WKHSURWHVWV of May 68’. I thought it was incredible that a person like Helmut, who was geographically and generationally of that moment, was hanging out on campus. Sergio Of course, I remember at that time you were distributing your writing. I remember one that said, “Osiris HVXQGLRVQHJURµ>2VLULVLVDEODFNJRG@,VWLOOKDYHWKDW poem. Frido That was actually a pamphlet that I gave out around college. Sergio I thought your poetry was really sophisticated. How do you think these two things relate for you? You had this acute understanding of language through your work with Kloaka and at the same time you had the performative and sexual experiences with us when you visited. Frido There was an important objective that lay behind my relationship with Kloaka: the intention to lift poetry from the paper and establish links between poetry, life and acWLRQ:KDWEURXJKWPHWR\RX>*UXSR&KDFODFD\R@ZDVWKH idea of experiencing the world through affect; something I noticed was a priority as soon as you decided to live together. Both experiences were about trying to deal with repression, but I think that only you managed to symbolize 100 101 the darkest aspects of those times. You surpassed the more traditional visual grammars and literal politics that occurred with a lot of the other artists on the countercultural scene at the time. What you were doing was profoundly political. The series of photographs that we collaborated on >UHIHUULQJWR6HUJLR@IRUH[DPSOHRosa Cordis>5RVH&RUGLV@ (1986) or Detritus>'HWULWXV@  UHVSRQGHGWRDVHULHV of questions that emerged from an intimate space but which also drew on a shared imaginary of oppression —for me this was very liberating. What I appreciated was how this experience totally unraveled my comfor table middle class situation. The present Sergio I see in us a snapshot of the times —bodies with DQLQWHQWLRQDOLW\DQGDJHQF\WRLQWHUYHQHLQDVSHFLÀF moment. What brings us together now is also the fact that we are active through practices that, in essence, haven’t changed that much from what we were doing back then. I have the impression that when we were starting these H[SHULPHQWVZLWKDOOWKHFRQÁLFWVDQGDJJUHVVLRQWKDW existed, there was an atmosphere charged with these inWHQWLRQV,WZDVQ·WGLIÀFXOWWRÀQGVRPHRQHZKRV\PSDthized with you and was willing to help you do something that you considered important —there were ideas exploding all around you all the time, even if some of them didn’t necessarily concretize. There was a permanent and effervescent indiscipline. Now I feel when I meet artists who are thirty years old or less, that there is a conservative or regulated atmosphere—as if everyone has to behave properly. Frido ,W·VPRUHVXSHUÀFLDOULJKW" Sergio Yes, much more. I don’t know if you feel the same, or what you attribute it to. Alfredo I think the Fujimori paradigm emerged victorious from the internal war.17 We live through a decade that isn’t post-Fujimorism but rather full blown Fujimorism —that’s how I see it. Us four were formed in a moment when everything was about how creative you were through education. Our parents worked themselves to the ground so that we could go to school. The paradigm that we grew up with was WKDWHGXFDWLRQZDVWKHNH\WREHLQJSRZHUIXOHIÀFLHQW free or whatever. And each of us took advantage of what we could —but this generation doesn’t exist anymore. I wouldn’t say that it’s better, just different. Sergio Which paradigm orientates the current generation? Alfredo Fujimorism implied a destruction of the social body as a living tissue. What we are experiencing now is the tissue as gangrene —without movement, dead tissue that continues to produce cells. People are still being born but without the capacity to connect or generate networks. The question is whether it’s possible to convert this into living tissue once again. It’s not like there isn’t any intense or high quality production, as it does exist. The problem is that the meaning and capacity for social interaction beyond its immediate environment is practically non-existent. That’s why I would say that the lack of a social fabric or tissue means that creative representations don’t represent anyone else apart from those who are creating or those who are already in it. Sergio And it just stays there. Alfredo Totally. I’m positive that there is someone making incredible post-industrial sound work but collectively, what GRHVLWPHDQ":KRLGHQWLÀHVZLWKLW":KDWNLQGRIVRFLDO fabric does it articulate? We are driving towards a total atomization and no one has the time to do anything else but produce more cash for a capitalist who is on top of you, organizing everything for someone else who is on top of him. It’s the neoliberal paradigm pushed to the extreme. Sergio Perhaps the way to confront the situation is through closeness and proximity. Alfredo Exactly. Perhaps this is linked with something beautiful you mentioned a minute ago. You said that back WKHQLWZDVHDV\WRÀQGVRPHRQHZKRZRXOGKHOS\RXWR make something “that you considered important.” I would say it goes even further: it wasn’t only that it was important but that it was precisely this that made us subjects. Or rather, being at one of Kloaka’s concerts or recitals was what allowed me to continue existing simply by exchanging energy with other bodies in space. That happened for me when I saw the exhibition of Grupo Chaclacayo at the Museum. I was with all of you but I was also with myself. I was conscious that that situation was constructing us. This idea about construction isn’t a positivist notion. It’s not simply the idea of becoming through mere accumulation. Now there are millions of things that happen and none of them have the tiniest importance or capacity to affect you. People go to see things and the dialogue is absurd: “How was it?” “Oh, it was ok, good I guess, I liked it.” It may seem stupid what I’m saying but it’s important. Before, these things were a matter of life or death. Sergio Totally. The fact that you were risking your life was something very present for us. Alfredo Yes. I think that you were more conscious that you were risking something. Now you are also taking risks but you don’t realize! You don’t realize because you’re practically vegetating. How many young old people are there? Sergio you said a while ago, “we’re still active” and that’s because we’re still young and we still feel the need and the relevance of risking everything for what we want to say —of getting things wrong and being willing to do it. But there is a load of young people who at thirty already want everything resolved, with an income that means they can pay their kids school or their grandchildren’s university. Their paradigms have nothing to do with ours —they’re old at the age of thirty! We are still asking ourselves things that we don’t get resolved for the following month. There are other emergencies. But there are also people from our generation who in one moment said: “No, I want to guarantee a secure life.” It’s not just that they broke away from the political or poetic, it’s simply that they became parts of the establishment. They were the real motor for change LQRXUJHQHUDWLRQ:HDUHDURXQGÀIW\\HDUVROGDQGLW·VRXU generation that is in power. I’m not referring to our classmates from art school or university but the entire group of people who are making the decisions in our country —running the economy, making public policy. So we continue doing our own thing but it’s a little bit like pretending to be young. Facing this kind of consensus that says that images don’t matter, my position is the opposite: I believe that the symbolic word has its relevance and it doesn’t matter if you’re not in charge of policy-making —suddenly with small FKDQJHV\RXDUHLQÁXHQFLQJVXEMHFWLYLWLHVZKLFKFDQ achieve powerful things you could never have imagined. Sergio Of course. There is little ability to critically confront the discourses that have been installed within the para- meters of the meaning of economies. For example the GHÀQLWLRQRIPDVFXOLQLW\WKHIDFWWKDWPHQKDYHWRDWD certain age, achieve this or that thing from a certain position. I also perceive that between the time that we were young and young people today, there is an increased slope RISHUFHSWLRQDQGUHDGLQJRIUHDOLW\7RGD\LW·VGLIÀFXOWWR propose something extreme and take it forward. That is, before I felt a lot of complicity from within the social body, even people not willing to accompany you so far but were ZLOOLQJWRVKDUHDQDIÀQLW\1RZ,IHHOWKHRSSRVLWHWKHUH are so few people who are really willing to take risks. Miguel It’s true. In what you call my generation, it seems LQFUHDVLQJO\GLIÀFXOWWRLPDJLQHWKHFUHDWLYHÀHOGDVSOD\LQJ a role in social and public life outside the logic of the market or corporation. And I’m not referring to participation as a tool of management, but rather the possibility for the symbolic to modify public sphere through nonconformity, to shift the way in which we relate to each other. There is a lack of imagination with regards to how the aesthetic might be able to locate and explore matters that we consider urgent like collectivity, the occupation of spaces, affecting our structures of desire, dismantling certain normative histories and producing other forms of subjectivity, sexuality, sociability and even love in a political sense. Alfredo Absolutely Miguel. But also there is something else: there are people from your generation who think that doing political art is doing representations of political discourses. But that is innocuous as they end up thematizing. When we talk about politics we are talking principally about the capacity to modify and change human relations —we’re not here to say: “this is the discourse,” or “this isn’t the discourse.” I feel that the possibilities for a person interested in the politics of visual production to have a sense of their own power has practically dissolved- and this has given rise to a discussion that is focused on the authority of politics rather than the operation of ones own politics. It’s just the same as saying: “Oh, politics, how boring.” It’s not one WKLQJRUWKHRWKHU,W·VOLNHQRWXQGHUVWDQGLQJWKHVSHFLÀFLW\ of power. Going back to the 1984 museum show, I remember I was a little overwhelmed: “These guys, so much meat put on display!” I felt they were exhibiting the visceral and it was huge. Of course now we have conceptual tools to understand notions like bio-politics or queer theory but back then it wasn’t part of the consensus of discussion, 102 103 even for those interested in the body. But it never ceases to surprise me how a lot of people interested in political art or politicized aesthetics don’t use these tools. Yesterday I was talking to Alex Ángeles [an ex-member of Los Bestias and 7DOOHU11@DQGZHZHUHWDONLQJDERXWWKRVHWZRXSFRPLQJ exhibitions in Lima [Perder la Forma Humana (Loosing Human Form) and Un Cuerpo Ambulante $:DQGHULQJ%RG\ @ It will give us a strong visual representation of a collective PRPHQWZLWKLQDVSHFLÀFKLVWRULFDOIUDPH7KHHLJKWLHVKDG its images.18 But what about the nineties? Or the 2000s? Or the 2010s? Seeing these images from the eighties you can see that there was a correspondence with the time, a brutal ability to represent the moment. But now I feel like LW·VGLIÀFXOWWRVD\WKHVDPH,·PQRWVXUH Homosexuality and politics Miguel In the press related to the exhibition in 1984 it is possible to sense a rejection of your homoerotic vocabulary. I remember an article by Luis Lama entitled Pobre Goethe>3RRU*RHWKH@ZKHUHKHH[SODLQVWKDW\RXH[WROOHG the “homosexual myth,” that you were a “paraphernalia of blasphemy,” accusing your practice as a pseudo art that FDPRXÁDJHVDQDSRORJ\IRUJD\QHVV19 This was evidence RI\RXULQDGHTXDF\EHIRUHWKHRIÀFLDOFXOWXUDOVSHFWUXP Lama’s phrasing is incredibly interesting because those bodies that he calls “abhorrent, sadomasochistic, decadent, perverse, blasphemous” are the announcements of the subjects of the revolution, those that the heteronormative tries to break at all cost. Sergio Yeah. I really remember that article. I also remember when Luis Lama visited us at the house. It was also interesting for me an interview I had with the anthropologist Rodrigo Montoya. In our conversations one of the limits was the topic of sexuality. That was when I realized this was the limit for a critical position on the left. I knew him personally through my family: my father, the magazine and his participation in the left movements. Even my father had a lot of problems with his expectations of masculinity —he had problems with me because of this. He was involved in militancy and was intensely critical of society. From a different place I also think about the reaction of progressive voices, like the critic Gustavo Buntinx. He reads an important part of our exhibition of 1984 as exhibitionism. I consider that, according to him to cross the line into a grammar that was deliberately homosexual meant diluting the political.20 For him the ways of articulating the political debate clearly had another formalization, more associated with works in direct collaboration with organized groups and social processes. Well, I guess everyone has their own way of understanding and projecting their politics. Alfredo It would have been great to see a Lima more affected by Grupo Chaclacayo: if you could have had a bigger impact on the city. If you had only been more visible in the public realm after the exhibition. You had initiated an unprecedented experiment with using the body in relation to questions of ideology and violence. It was a mix that hasn’t been repeated. What can happen now with the sudden appearance of this work again in 2013? Sometimes, I can’t help but feel that there aren’t that many possibilities for a situation like this to be truly effective — not because of the work itself, which is powerful, but because there is too much dead tissue, as I said. For the VSDUNVWRÁ\LWVQHFHVVDU\WKDWVRFLHW\LVUD]RUVKDUSDVZHOO Sergio In terms of the media, nothing will happen —that’s clear. For me the question is rather what could happen XQGHUQHDWK"/LNHZKHQ\RX>/RV%HVWLDV@ZHQWWRVHHWKH exhibition in 1984. There is a kind of relation of non-conformist bodies, of micro-fabrics between people in the VDPHWHUULWRU\DQGSHRSOHIURPRWKHUÀHOGVRISROLWLFDODQG FXOWXUDODFWLRQ³LW·VWKHUHZKHUHWKHVLJQLÀFDQWLQÀOWUDWLRQV occur. Miguel I do think that right now there are boiling points that are placing the normalized structures of the social body in crisis. What about the rage that the same sex civil union project is producing in Peru? There have been homophobic reactions and they are going to intensify as we get closer to the moment of the decision by the Congress. This puts on the stage the limits of what can be considered acceptable and what cannot be passed under any circumstances. Not only here but in Ecuador as well: a couple of months ago the leftist President, Rafael Correa, slyly blocked a program put forward by the progressive left seeking to decriminalize abortion in the Penal Code —and it was abortions in the case of rape! His rejection of the proposal was because of his membership to the Catholic Church.21 I feel so ashamed of this left that calls itself progressive but is incapable of seeing these transversal ÀJKWVDVXUJHQW7KRVHZKRDUHÀJKWLQJIRUDUHLQYHQWLRQ of the democratic project from a position of gender or sexuality don’t have a voice within these old spaces of militancy. But against the orthodox left there are now micro-groups of young people, active and daring to innovate and renovate them. They can make spaces with the images that we’re going to exhibit that will be spaces of symbolic disobedience and affective recognition. I said this to Helmut when we looked over his works stored in boxes in his small town in Essen, Germany: “These materials have not yet liberated all of their battles. We’re in a war DQGZHQHHGWRNHHSÀJKWLQJ:HKDYHWRUHWXUQWKHVHWR WKHSXEOLFUHDOPVRWKDWWKH\FDQÀJKWZLWKXV:HQHHG allies and these images afford alternative dreams of another history.” It is probably this contact that will make WKHVSDUNVÁ\$QGVXGGHQO\ZH·UHVKRZLQJWKHVHDUWZRUNV at the Museum of Art in Lima again, a space of such symbolic power! I have no doubt that there will be attacks of the exhibition —and this could be positive. Also, when the museum puts these transvestite practices, homosexual denouncing of violence and queering of power behind glass it will say loud and clear that these queer practices DUHLPSRUWDQWIRUXQGHUVWDQGLQJRXUVHOYHVDQGGHÀQLQJ ourselves as social subjects, collectively active and critical. It’s really decisive. This isn’t happening anywhere else in institutional art world space in Lima. Alfredo It’s really interesting what you’re saying Miguel. Effectively, this counter position could allow for the inversion of the latent puritanism that characterizes those spaces that organize collective energies. I’m not just talking about the museum but the whole structure of national power at a macro level. It’s not important if you are from the right or the left, in the end there is a puritan impulse that says that things should remain normalized— any other way is not only impossible but must be repressed. To draw attention to this is really important, because I see Grupo Chaclacayo as an exercise that violates conventions, not because you were necessarily looking to be ‘unconventional’ but because of something more simple: your territory of experience and affective exchange was that. Shining Path Alfredo ,ZDQWHGWRDVNDVSHFLÀFTXHVWLRQDWZKDWSRLQW did the legitimacy of the war of the armed rebels become associated with the visual and discursive production of Grupo Chaclacayo? Sergio That was a weird situation. I can tell you how they used this argument, but behind it there is a lot going on. I think it’s basically simple: those who are in different positions of power (journalists, critics or the institution) are looking for a possibility of boxing in our experience, categorizing it and disqualifying it. At the time, being linked with Shining Path’s war was one of the more powerful ways to eliminate or destroy someone. Alfredo It still is. Sergio Exactly. Many different ways have emerged since then of perversely eliminating your neighbor. In the 1984 exhibition there wasn’t anything to accuse us of. It was only in 1989, when we were outside of Peru, that art critic Luis Lama wrote a three-page article in the Caretas magazine called “Perversión y complacencia. Estridente y frívola apología de artistas peruanos en Berlín Occidental” [Perversion and Complacency. Frivolous Apologyes by Peruvian $UWLVWVLQ:HVW%HUOLQ@7KHVDPHSHUVRQUHSHDWHGWKH accusation in the same magazine in 2002.22 Alfredo When did you leave Peru? Sergio In January 1989. To summarize: they had two hooks that they used to prove that our work was supposedly DQDSRORJ\IRU6KLQLQJ3DWK7KHÀUVWZDVWKHDFNQRZOHGJments we made in the exhibition catalogue for Todesbilder >,PDJHVRI'HDWK@LQ*HUPDQ\LQ,QWKHFDWDORJXHZH thank to Sybilla Arredondo, who was already being chased down. We said: “To Sybilla Arredondo for helping to secure the rights for these Arguedas texts.” The second catch is LQWKHODVWSDJHVRIWKHERRNZKHUH\RXFDQÀQGDOLVW entitled: “About the political violence that has occurred in Peru since we have been producing work as the Grupo Chaclacayo.” And we decided to make a list of the political violence operating within the institution because we were interested in dismantling the legitimacy of the institution as a guiding force in society. 104 Alfredo You had this clear at the time? Sergio Yes, we were totally clear about it. Now, I think that behind this there was something that Miguel has said in a text a while ago about how our work represented a kind of danger so unmanageable that it’s associated with the most violent kind of communism.23 Miguel I tried to draw attention to the danger that homosexual entities provoke for a national body that is clean, healthy, obedient, reproductive and always heterosexual. This call to the heterosexual order is precisely how the contemporary tools of governance and organization of the body function today —they demand that the institution complies with its disciplinary role. These institutions are not only the museum but the family, the school, the hospital and the factory. It’s not enough to say that the link between Grupo Chaclacayo and Shining Path is preposterous. For me it is profoundly complex because the link is in the explosive —in that this group of queers and their abject grammars were seen as threatening and as violent as an armed and uncontrollable group of revolutionary Maoists. It’s interesting that the indignation that Lama felt in 1984 brings him to pathologize homosexuality. What he demands in his second article in 1989 is your extermination: an accusation of being an apologist for Shining Path in Peru meant nothing other than a possible kidnapping and imminent execution. This was not only a battle against sexually dissident bodies but also against those bodies with piercings, the vampire identities, the zero-positives, the autistic, the migrants without papers, the disabled... >ÀJÀJ@ Sergio That includes the body of a woman who is not complying with the normative function required by society. This disobedience is equally rejected and destroyed. Alfredo Of course, but this argument contradicts the link with the Maoist Shining Path group –they were more puriWDQVWKDWWKH6WDWH,WLVLPSRVVLEOHWRÀQGTXHHUUHSUHVHQtations within Shinning Path. Sergio That’s the interesting thing! In that contradiction becomes clear that what was at stake was the subversive itself beyond any ideological agenda. 105 Miguel The question I asked myself was the following: “Against what subjects does the society declare war?” It’s a war against a group of entities that don’t harmonize with the national-catholic paradigms of false happiness. It’s against the bodies that are not useful for the productive demands of capitalism and for reproduction of the heterosexual model. Even though there is not a single thing that these bodies (a queer and a Shining Path militant) share. The war is declared against those bodies that can’t be absorbed by the establishment. Alfredo I totally agree. This is the case with the image of 0DRWKDW11SURGXFHGLQ>ÀJ@7KLVTXHHULQJRI Mao was unfathomable, as much for Shining Path’s people as for the State. And of course, it just so happened that they won the war. But I remain convinced that if Shining Path had won the war, these kinds of representations or queerings of Mao would not have been taken lightly. I’m MXVWWU\LQJWRVHHLIWKHUHLVDZD\WRÀQGLQZKDWZHDUH talking about, something that would make visible the way that reality has been structured —and I’m talking from the present. Sergio I would say it’s important to think about how these kinds of political practices —the State and the institutions— continue to operate in the same way. What was inscribed in the eighties has been reinforced internationally since the Twin Towers attack in 2001: it’s the military monopoly of the state that calls any criticism against the status quo, the economy or the nation ‘terrorism.’ It has become commonplace on university campuses and in the tabloids —the TXDOLÀHU¶WHUURULVP·KDVVSUHDGTXLFNO\ Alfredo This requires the creation of other categories to be able to discuss these issues. Sergio I insist on the need to emphasize that power produces fear. It’s not possible any other way. If we’re talking about terrorism then we’re talking about the state and LQVWLWXWLRQVDQGVSHFLÀFVWDWHERGLHVWKDWRUJDQL]HSRZHU on a large scale. Only then can we talk about terrorism. For HYHU\WKLQJHOVHZHKDYHWRXVHDQRWKHUTXDOLÀHU,SUHIHU ‘undisciplined’ because it recalls a basic experience that we all go through. It’s something that everyone has been through —from the most adapted or adjusted to the most reactionary. Everyone can remember a moment in their childhood. What does undisciplined mean and how important was it as an experience for us? Everyone knows that it was a risk when all this happened. Alfredo Yes, and that’s why the potential of symbolic power is always on the table. We don’t have the power of persuasion or weapons that the coercive institution wields. We only have symbolic power, which is the territory that we occupy and can debate with you or whomever. Sergio There is a saying that we’ve seen written in big letters in the schools: “Order is culture.” This way of thinking is institutionally entrenched even in the sectors of the progressive left. It betrays a fascist mentality, especially if the slogan is inverted: “culture is order.” There is clearly a group of people who support the idea that culture should be order, and others who propose culture as disorder. Dirty experiences like Kloaka, Los Bestias using garbage or Grupo Chaclacayo exposing sexuality and violence were unEHDUDEOHEHFDXVHWKH\ZHUHDQDIÀUPDWLYHFUHDWLYHUHVSRQVHWR the chaos. What has expanded today is the fear of disorder, of uncertainty, of structural disorganization —of a grammar that doesn’t adjust to the well known political vocabulary. It is seen as VRPHWKLQJWKDWJHWV\RXÀOWK\DQGWKDWPLJKWFRQWDPLQDWH\RX,W is not seen as a critical position capable of questioning the tradiWLRQDOIRUPVRIUHSUHVHQWLQJFRQÁLFWV,WLVQRWSHUFHLYHGDVVRPHthing that opens up a territory for new possibilities but rather as something disruptive that should be put under control and disciplined. That’s why I can’t help but think that even if the left had arrived to positions of power their mentality, from the moderate to the most radical, means that they probably would have used the same mechanisms of repression as any right wing politics. Jaime Higa (El Callao, 1960) He studied at the School of Visual Arts of the Universidad Católica (1980-1984). He has done set design for concerts, dance and theater performances, as well as designs for independent maga]LQHVERRNVDQG&'V+HKDVKDGÀIWHHQLQGLYLGXDOVKRZVLQGLIIHUent cities, and participated in over 150 group exhibitions in cities such as Buenos Aires, Montevideo, Los Angeles, Mexico City, Caracas, Barcelona, Bridgeport, and San Antonio, among others. Notable among the awards he has received is First Prize at the Sixth National Painting Salon at the Peruvian-North American Cultural Institute (1989). He lives and works in Lima. Alfredo Márquez (Lima, 1963) Architectural designer, visual artist, and cultural promoter. He studied Architecture and Urban Development at the Universidad Ricardo Palma. He has participated in the collectives Bestiarios/Los Bestias; Taller NN; Made in Perú; and Perufabrica. His work forms part of the underground movement, urban pop art, and Lima’s counterculture. He has participated in solo and group shows in Peru and abroad. His works form part of the collections of the Museo de Arte de Lima, the Harvard Art Museum, and the Micromuseo (“al fondo hay sitio”), among others. He lives and works in Lima. Frido Martin (Lima, 1963) Pseudonym of Marco Antonio Young Rabines. Poet with a degree in Linguistics from the Universidad Nacional Mayor de San Marcos. Together with Rodrigo Quijano and Fernando Bryce, he was one of the participants of the Kloaka movement. Around the same time, he collaborated with the Grupo Chaclacayo. He is the author of several poetry collections, such as Naufragios (6KLSZUHFNV) (2003). In 2011, he took part in a CD compilation of sound poetry issued by Buh Records. In 2012, he founded La Horda de la Calma perfo-poetry collective, together with other performers, musicians, and poets. He is currently experimenting with poetry and performance, and preparing a book of poems with an accompanying interactive CD. He lives and works in Lima. 107 Documentos 106 (artículos y prensa) Documents (articles and press clippings) 109 Joseph B. Adolph. “H.J. Psotta: Todo y/o Nada” (Entrevista) (1982) 133 Joseph B. Adolph. “H.J. Psotta: All and/or Nothing” (Interview) (1982) 112 Joseph B. Adolph. “¿Qué pasa en Chosica?” (Entrevista) (1983) 135 Joseph B. Adolph. “What’s happening in Chosica?” (1983) 115 Miguel Silvestre. “Cuando el ser auténtico resulta ser peligroso” (Entrevista) (1984) 138 Miguel Silvestre. “When one’s authentic self turns out to be dangerous” (Interview) (1984) 116 Hugo Salazar del Alcázar. “Chuang-Tse, Freud y el sueño peruano” (ca.1984-1985) 139 117 Sergio Zevallos. “La muerte obscena / Perú: 1982-1988” (1989) Hugo Salazar del Alcázar. “Chuang-Tse, Freud and the Peruvian dream” (ca. 1984-1985) 119 Claudia Peter. “Arte sudamericano de dolor, rabia y asco” (1989) 140 Sergio Zevallos. “The Obscene Death / Peru 1982-1988” (1989) 120 Autor no identificado. “Imágenes de la muerte” (1989) 142 Claudia Peter. “A South American art of pain, rage, and disgust” (1989) 122 Dorothee Hackenberg. “Dieser Brutalität der Sanftheit. Interview mit Helmut J.Psotta, Raúl Avellaneda, Sergio Zevallos von der Grupo Chaclacayo über ‘Todesbilder’;” y “Heilige Folter-Rosa!” (1990) 142 Unknown author. “Images of death” (1989) 144 Dorothee Hackenberg. “Esa brutalidad de la dulzura. Entrevista con Helmut J. Psotta, Raúl Avellaneda, Sergio Zevallos del Grupo Chaclacayo sobre ‘Todesbilder’;” y “¡Santa Tortura-Rosa!” (1990) Dorothee Hackenberg. “The brutality of a soft touch. Interview with Helmut J. Psotta, Raúl Avellaneda and Sergio Zevallos of the Grupo Chaclacayo on ‘Todesbilder’;” and “Holy Torture-Rose!” (1990) 149 Michael Nungesser. “The womb of evil” (1990) 129 Michael Nungesser. “El útero del mal” (1990) 150 Michael Haerdter. “Images of death. Peru or the end of European dream” (1990) 130 Michael Haerdter. “Imágenes de la muerte. Perú o el final del sueño europeo” (1990) 153 Bibliography 153 Bibliografía 124 108 109 Cuatro textos importantes no pudieron ser incluidos en esta sección porque no se obtuvo el permiso de reproducción de los autores: Buntinx, Gustavo [Sebastián Gris]. “Una experiencia extrema en nuestro arte.” El Caballo Rojo, suplemento de El Diario de Marka. Lima, 28 de marzo del 1983, pp. 10-11; “Grupo Chaclacayo. Los cuerpos del delito.” La República, Lima, 9 de diciembre de 1984, p. 49. Lama, Luis “Perversión y complacencia.” Caretas, Lima, 20 de noviembre de 1989, pp. 74-76; “Pobre Goethe.” Caretas, Lima, 3 de diciembre de 1984, pp. 62-63 [Joseph B. Adolph], “Todo y/o Nada,” Lima Kurier. El mensajero de Lima, Lima, n. 25 (julio de 1982), pp. 1-3. 110 111 112 J[oseph] B. A[dolph], “¿Qué pasa en Chosica?,” Lima Kurier. El mensajero de Lima, Lima, n. 40 (diciembre de 1983), pp. 1-3. 113 114 115 Miguel Silvestre, “Cuando el ser auténtico resulta ser peligroso,” El Diario Marka, Lima, 27 de noviembre de 1984, p. 18. 116 Hugo Salazar del Alcázar, “Chuang-Tse, Freud y el sueño peruano,” manuscrito inédito, Lima, ca. 1984 -1985. CHUANG-TSE, FREUD Y EL SUEÑO PERUANO 1 &XDQGR&KXDQJ7VHFRQWyODIiEXODGHODÁRUTXHVRxyVHUPDULSRVD\TXHDOGHVSHUWDUQRVDEtDVLHUDXQDPDULSRVD VRxDGDSRUODÁRURODÁRUTXHVRxyVHUPDULSRVDGHDOJXQDPDQHUDHVWDEDDOXGLHQGRDORTXH)UHXGHQVX´,QWHUSUH tación de los sueños”, denominaría como sustitución y desplazamiento onírico. El territorio de los trabajos y propuestas visuales de la muestra “Perú... un sueño”, nos vuelven a remitir a Chuang-Tse y su fábula. Condensación, sustitución y desplazamiento de lo soñado (imaginarizado) como objetos, imágenes, ambientaciones y eventos que se materializan en una propuesta que el espectador debe esforzarse en reelaborar de una manera DOHDWRULD\FRPELQDGD$OOtFRPRHQODIiEXODGHODÁRUODVLPiJHQHVHYRFDGDVDWUDYpVGHLQWXLFLRQHVUHYHODFLRQHVD la manera de un juego de espejos o cajas chinas, empiezan a entremezclarse y a reclamar una virtual materialidad. 2 “Perú... un sueño”, se articula, pues, al modo del mecanismo del sueño: imágenes libres de censura y represión, y también de lógica del nivel consciente y materializadas, a veces como una efusión poético-visual, otras como patética demonología o mórbida pesadilla que se quiere negar, y que sin embargo existe, como existe dentro de ellas la lucha del ángel y el demonio que se quieren expiar, mutuamente. Y en esta lucha también está la lucha del impulso de la vida y el de desWUXFFLyQORVIDQWDVPDVSULYDGRV\FROHFWLYRVDJD]DSDGRVHQDOJ~QOXJDUGHOLQFRQVFLHQWH,PiJHQHVGHVDQWRVVH[XDGRV ritos mágicos, crímenes, capillas ardientes, todo entremezclado y al mismo tiempo. Empiezo a evocar a Bataille, a LautréPRQWD3DVVROLQLDODVYDJLQDVGHQWDGDVGHQXHVWUDVFXOWXUDVSUHFRORPELQDVDOD,QTXLVLFLyQORVULWRVIXQHUDULRVGHO PXQGRDQGLQR\ÀQDOPHQWHDODYLROHQFLDItVLFDGLUHFWDRFLUFXQVWDQFLDOSULYDGD\QDFLRQDOTXHQRVKDWRFDGRYLYLUHQ estos últimos años. ¿Es esto el sueño nacional? 3 Estas imágenes, como las imágenes de los sueños, están sobredimensionadas, mutiladas, sexualizadas y recontextuali]DGDV+D\XQDFRQVWDQWHGHDXWRPXWLODFLyQ\WUDYHVWLVPRGHODVLPiJHQHVÀJXUDOHVGHORVDFWRUHVGHHVWHLQWHQVRH[SH rimento, que si bien en un primer momento se puede intuir como una efusión narcisística, poco a poco se va trocando en REMHWRGHDQiOLVLVHYHQWRLGHROyJLFRRUHÁH[LyQVRFLRDQWURSROyJLFD3DUDORJUDUORVHDSR\DQHQHOUHLWHUDGRXVRRPHMRU dicho, deliberado abuso, de los componentes más profundos e intrínsecos de nuestros mitos colectivos e individuales: el sexo, la religión y la muerte. Entonces las transgresiones, mutilaciones, travestismos, inscripciones parten del cuerpo ItVLFRSDUDDUULEDUKDFLDRWURREMHWLYRÀQDOHOFXHUSRVRFLDOHLGHROyJLFRSHUXDQR<MXVWDPHQWHHVWDVLPiJHQHVSRUDUWL ÀFLRGHOVtPEROR\ODPHWiIRUDQRVGHYHODQODLPDJHQGHOFXHUSRVRFLDOSHUXDQRLQRUJiQLFRPXWLODGR\GHVHVWUXFWXUDGR 4 En este sentido, las operaciones visuales y no objetuales del alemán Helmutt Psotta y los peruanos Raúl Avellaneda y Sergio Zevallos, autores de “Perú... un sueño”, parten de lo visual para instaurarse en lo ético. Frontera en que el estilo de vida y el estilo de arte se empiezan a disolver y perder sus delimitaciones habituales. Cuenta para ello en esta historia, la fábula de Chuang-Tse sobre la frontera entre los sueños y lo soñado, y otra de Freud, cuando estudiando los sueños, escribía que para experimentar la posibilidad de saciar su sed, tomaba su última comida con exceso de sal, para así experimentar de mejor manera el placer del vaso de agua al despertar en medio de un sueño en que había evocado la apremiante sed. 5 De algún modo Psotta, Avellaneda y Zevallos con la exposición “Perú... un sueño”, se han preocupado en hacer subir la cuota de sal (y ají) al sueño peruano y mostrárnoslo en toda su crueldad y poesía, en toda su verdad y mentira. Sin embargo ahora más que nunca necesitamos el vaso de agua que Freud ponía en su mesa de noche, o por lo menos despertar. 117 Sergio Zevallos, “La muerte obscena / Perú: 1982-1988. Una obscura matriz para mis imágenes,” manuscrito en español inédito. Publicado en alemán como “Der Obszöne Tod. Peru: 1982-1988. Eine finstere Gebärmutter für meine Bilder,” en Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin, Alexander Verlag, 1989). LA MUERTE OBSCENA / PERÚ: 1982-1988 Una obscura matriz para mis imágenes He de referirme en el siguiente escrito a motivaciones y circunstancias vitales, cuyos contenidos forjáronle un carácter a los ciclos de imágenes que realicé dentro del proyecto PERÚ... UN SUEÑO del Grupo Chaclacayo. Por anticipado debo señalar que el distanciamiento físico y a consecuencia psicológico de la realidad y norma común a los peruanos, sin excluir la observación crítica de aquello, fue la posibilidad única para desarrollar incondicionalmente mis expresiones. Una abundancia creativa también originada de mi encuentro con Helmut Psotta, siendo su sentido la intensa confrontación de conciencias y sensibilidades crecidas en realidades radicalmente opuestas del Occidente actual; lograr con ello y debido DODLPSDUFLDOLGDG\PXWXRUHVSHWRXQHVSDFLRLGHDOSDUDGHVPLWLÀFDFLRQHV/XHJRODFXOWXUDFULVWLDQDFRPRSULQFLSLRLQherente a toda causa histórica, neutralizó las aparentes diferencias estableciendo espontáneamente un punto de partida para nuestras representaciones. Ser peruano hoy en día es haber crecido en un país fundamentado en la amenaza constante del individuo como PpWRGRGHFRQWURORÀFLDODFHSWDGRSRUWRGRVHVVRSRUWDULQHUPHXQGUiVWLFRGHFDLPLHQWRPRUDO\VXVHFXHODHQODDXVHQFLDGHLQKLELFLyQSDUDDVHVLQDUDFRVWXPEUDUVHHQGHÀQLWLYDDPXHUWHVEDQDOHVSRUVLPSOHVHUURUHVHYLWDEOHVRWDPELpQ deliberados. Tantas agresiones simultáneas terminan por invertir la existencia en su sentido mismo. Vivir promiscuo con la Muerte que nos obliga al consumo visual de abundantes cadáveres, quienes se tornan en protagonistas de una grotesca “Tragedia Humana” exponiendo su indecencia ante nuestras miradas aún más indecentes; lúgubre escena de una vida cotidiana extraviada en esta historia irracional. Si lo anterior parece ser una pesadilla, mis trabajos deben asumir la misma naturaleza obsesiva que les conduzcan sin desvío a las entrañas del ser. Esta disposición anímica ya guiaba al primer ciclo de acciones que realicé en los suburbios de Lima bajo el título “Pasiones de un Cuerpo Ambulante” –encarnación de un destino colectivo. En la matriz misma donde creció mi juventud interpreté la morbidez de una Danza Macabra rodeada de escombros, el cuerpo GHVQXGRDWDGRSRUYHQGDMHVSHUVRQLÀFDQGRODLPSRWHQFLD\DXVHQFLDGHYHUJHQ]DDQWHHODEDQGRQRFRPRXQDHVWDWXD sensible sobre fría piedra en medio de la tormenta. Paralelamente al desarrollo de mis dibujos he ido reuniendo un “corpus” de textos e imágenes de uso popular, referidos a cultos y mitos sean religiosos o profanos en los cuales orientarme. Un constante vincular historia y presente teniendo mi propia biografía como punto de reunión de todos los elementos dados. Encuéntranse allí el patetismo católico en su expresión colonial más acabada, el mito de Santa Rosa de Lima, con la idolatría de hombres por hombres en HOFXOWRDORVKpURHVQDFLRQDOHVHO7ULEXQDOGHO6DQWR2ÀFLRGHOD,QTXLVLFLyQFRQVXHTXLYDOHQWHDFWXDOODLQVWLWXFLyQGH la tortura en los interrogatorios policiales; las deformaciones urbanas del antiguo funeral andino con los entierros FODQGHVWLQRV\WUiÀFRGHYtFWLPDVGHOSRGHUSROtWLFR6DQJUH²LQFLHQVR²FHQL]DVRQDTXtPDWHULD\PHWiIRUDSDUDHVH deslizamiento enfermizo de la lujuria hacia la muerte que avanza subterráneo de un caso a otro, atavismo insuperable FX\RRULJHQVHUHPRQWDDODFUX]DGDHYDQJHOL]DGRUDGHOVLJOR;9, Un vivo ejemplo de aquello nos muestra la “Procesión del Señor de los Milagros” que cada octubre desborda las calles limeñas con su multitud amorfa de color violáceo. Aletargados, sudorosos y sumergidos en nubes de incienso soportan el peso de un Cristo impasible y estéril para sus desmesuradas ansias pseudo religiosas. Uno se siente retrocedido en la historia viendo pasar en “Marcha Fúnebre” esta masa ignorante que unos obispos aburridos bendicen mecánicamente; enorme sumisión de un pueblo que hace tanto tiempo olvidó su verdadera identidad. Al otro extremo mítico indígena se encuentra símbolos más elocuentes para la usurpación cristiana de sus contenidos auténticos. En ciertas ]RQDVDQGLQDVODWLHUUDLGHQWLÀFDGDFRQOD9LUJHQVHODDVRFLDWDPELpQDORVEDWUDFLRVVXLQYRFDFLyQFRPRGHLGDGKHPEUD bajo el nombre de Santa María SAPO se cumple en medio del suplicio de estos animales, cuyos gemidos deberán “seduFLUµDO'LRVGHO$JXDSDUDTXHVHGHUUDPHVREUH(OOD+HDTXtHO0LVWHULRGHOD,QPDFXODGD&RQFHSFLyQUHYHUWLGRDVXFRQdición profana y biológica en esta combinación metafórica Sapo-Mater Dolorosa, para poder aguantar así el destino trágico de la “Madre Tierra” bañada en sangre por los conquistadores europeos. Tales simbiosis de símbolos me fascinan de sobremanera y cautivan para visualizarlas. Surge entonces la pregunta ¿cómo oponerme a esta enorme acumulación de demencias? La burla espontánea ha sido siempre mi aliada y al interior de dicha actitud he hallado un auténtico principio creativo en la transgresión de toda norma e ideología dogmáticas, invirtiendo sus sentidos tradicionales vía asociaciones libres o premeditadas. Sin embargo, al constituir esta nueva forma simbólica encuéntrome en el camino de retorno hacia la grave seriedad de los hechos, inclinando de este modo todo el peso de la “balanza” -mi biografía- del lado humano. Convertir mi experiencia de violencia en capacidad para expresarla lo más sensible y fuerte que me fuera posible, ese es mi ideal. /DHVWpWLFDTXHGHVDUUROORWLHQHDGHPiVXQDLQÁXHQFLDHVSHFtÀFDODPLVHULDVXDVSHFWR\ODVHVFHQDVTXHJHQHUD (VWR\GHÀQLGRSRUXQDVHQVLELOLGDGIRUPDGDHQODSHUPDQHQWHSHUFHSFLyQGHPXODGDUHV\GHJUDGDFLRQHVKXPDQDVDOOt donde se pasea la vanidad prepotente de la clase dominante, marginándolo todo bajo una vulgar capa de maquillaje. 118 Es en aquella mezcla que hallo lo verdaderamente obsceno. Pero disimular la miseria espiritual o física y pensar sólo en ORµEHOORµVHJ~QXQDDPELYDOHQWHPRUDOHVHQFLDGHONLWVFK\GHOFLQLVPRVRQUDVJRVJHQHUDOL]DGRVHQ2FFLGHQWH(VWDHV la MUERTE OBSCENA. De allí que la “libido” de los objetos usados, luego la consciencia del empleo banal o brutal que los GHWHUPLQyÀQDOPHQWHHOVHQWLGRUHVXOWDQWHSRUVXVFRPELQDFLRQHVGLDOpFWLFDVKDQVLGRHVWtPXORVHVHQFLDOHVSDUDHODERrar un lenguaje en forma Simbólico-Huella o Símbolo-Llaga, reliquias profanas de mi particular manera de mirar. (QHVWDFRQÀJXUDFLyQODGHVQXGH]YHUGDGHUR&RUSXV'HOLFWLHVVLHPSUHVLJQLÀFDWLYDGHODVHVLQDWRSRUHYRFDUHVD animalidad anterior al humano, violencia primordial de donde procedemos. Lo sexual ha de contagiarse del mismo sentido, su alusión más o menos directa introduce un vertiginoso sentimiento de interdicto logrando así la tensión máxima SRVLEOHHQXQDLQIRUPDFLyQVtQWHVLV<QXHYDPHQWHODUHDOLGDGPHMXVWLÀFDYLRODFLRQHV\WRUWXUDVH[XDOXVDQGRHOSHQH FRPRLQVWUXPHQWRGHVRPHWLPLHQWRVRQDFWRVMDPiVVXSHUDGRVSRUQXHVWUDFXOWXUD'HDTXHOORVHLQÀHUHHOSULQFLSDO destinatario de mi mensaje... hombres, más exacto la especie de hembras sin útero en que degeneramos. $~QGHQWURGHOWHPDPHQFLRQDUpDTXHODFWRIHQRPHQDOTXHUHVXPHWRGDVODVYDULDQWHVGHPLDQWHULRUUHÁH[LyQ el entierro lascivo de Santa Rosa (Lima, 1617), donde un pueblo ávido de poseerla en reliquia profanó su cuerpo indefenso apenas fallecido. Esta pobre hija del catolicismo hasta hoy ultrajada por la devoción masculina -que así pretende expiar su frustrada sexualidad- convirtiéndola en un ser híbrido de Virgen y Verdugo a quien venerar. Ella es una constante en mi WUDEDMRSXHVDEDUFDDTXHOORVPDWLFHVTXHYDQGHOHURWLVPRKDFLDODEUXWDOLGDGPHUHÀHURQDWXUDOPHQWHDOPLWRTXH/D ,JOHVLDSRPSRVDPHQWHGLIXQGH Todos estos contenidos deberán relacionarse entre sí en una secuencia cíclica, volviendo siempre al caos elemental de donde surgieron para alcanzar nuevamente desde allí su forma explícita cada vez más libre y contundente. Hacer de ello un espejo, una Fisonomía de la Condición Humana, capaz de evocar la sensación concreta de lo que deseo expresar, esto es: la crueldad y el asco que me produce. 119 Claudia Peter, “Südamerikanische Kunst aus Leid, Wut und Ekel,” Stuttgarter Nachrichten, Stuttgart, 6 de junio de 1989. ARTE SUDAMERICANO DE DOLOR, RABIA Y ASCO Imágenes de la muerte del “Grupo Chaclacayo” del Perú en el Instituto de Relaciones Internacionales En 1982, el artista alemán Helmut Psotta se retiró de la plaza que tenía como profesor invitado en la Universidad [Católica] de Lima para dedicarse al arte con sus alumnos Sergio Zevallos y Raúl Avellaneda a un pequeño oasis en la sierra de Chaclacayo, impulsados por un sueño común de paz y libertad. Los dibujos, objetos, esculturas y performances que de allí surgieron, no muestran sueños utópicos sino, más bien, interpretaciones traumáticas y excesivas de la violencia, del miedo y del terror como [una manera de] superación visible del dolor psicológico y físico. Hay dos emociones que impulsan a Sergio Zevallos a luchar artísticamente contra el terror y los asesinatos en el Perú: la ira y el asco. Los artistas se basan en metáforas que han sido ampliamente reprimidas de la vida cotidiana ²QDFLPLHQWR\PXHUWHHURWLVPR\VH[XDOLGDGVDQJUHTXHÁX\HPXHUWRVDPRUWDMDGRVVtPERORVVH[XDOHVUHSUHVHQWDQGR YLRODFLRQHVLFRQRJUDItDFULVWLDQDGHVPLWLÀFDGDGHPDQHUDEODVIHPDHOVKRFN\HOKRUURUPRVWUDGRVGLUHFWDPHQWH y sin reserva. Un ejemplo es la caja-objeto de Raúl Avellaneda: una gran araña sobre una peluca rubia representa los pensamientos infames de los blancos, quienes durante siglos han explotado a mestizos, indígenas e indios. Los artistas buscan auténticos modos de expresión: europeos (Psotta) y peruanos (Zevallos, Avellaneda) -de modo que ambas perspectivas se encuentran representadas. (VWHSUR\HFWREDMRHOWtWXORGH´,PiJHQHVGHODPXHUWH3HU~RHOÀQDOGHOVXHxRHXURSHRµHVXQLQWHQWRDUWtVWLFR audaz para exigir la liberación de la historia colonial y sus consecuencias respectivas. Es audaz de dos maneras: por un ODGRPXHVWUDXQDDSHUWXUDDXWRUHYHODGRUDTXHUHÁHMDDELHUWDPHQWHODYHUGDGSVLFROyJLFD\SRUHOORODKDFHYXOQHUDEOH y por otro está el temor existencial de Zevallos y Avellaneda de regresar al Perú, por las consecuencias incalculables que este proyecto podría traerles en su patria. (O,QVWLWXWRGH5HODFLRQHV,QWHUQDFLRQDOHVGH6WXWWJDUWFX\RGLUHFWRU+HUPDQQ3ROOLJWHQtDPRWLYRVSDUDHVSHUDU reacciones extremas y violentas de la audiencia, es el primer lugar de la itinerancia de la exposición, conferencias y performances de los tres artistas. Su itinerario continúa en el Museo de Bochum, en el Badische Kunsterverein Karlsruhe \HQHO.QVWOHUKDXV%HWKDQLHQHQ%HUOtQ 120 [Autor no identificado], “Todesbilder,” ZYMA Kunstmagazin, Stuttgart, n. 2/3 (mayo-agosto de 1989). TODESBILDER (Imágenes de la muerte) Perú o el fin del sueño europeo Grupo Chaclacayo ´&DGDFXOWXUDUHSUHVHQWDXQD~QLFDHLUUHPSOD]DEOHFRQMXQFLyQGHYDORUHV3RUHOORODLGHQWLGDGFXOWXUDO\VXDÀUPDFLyQ contribuyen a la liberación de los pueblos. En contraposición a ello, toda forma de dominación solamente representa una imagen distorsionada de esa identidad”. Estas palabras se encuentran en la declaración de la UNESCO de 1982 y fue emitida por los representantes de los países industrializados de Europa en Ciudad de México. Para los miles de desaparecidos por el poder político, aquellos que ya no tienen voz para comunicarnos qué es lo que sucedió en realidad. Clama justicia la exposición Todesbilder>,PiJHQHVGHODPXHUWH@GHO´*UXSR&KDFODFD\RµHQHO,QVWLWXWRGH 5HODFLRQHV,QWHUQDFLRQDOHVGHODFLXGDGGH6WXWWJDUW\DTXHOTXHODYHFRQRMRVGHVRUELWDGRVSRUHOWHUURUGHVHDGHVGH lo más profundo de su corazón que termine el sueño europeo y que despierten los soñadores europeos. Si al traer ante nuestros ojos estas imágenes de espanto y terror, la intensión del organizador de la exposición fue realmente dar vida a la dedicatoria del catálogo, entonces ha cavado surcos en nuestros espíritus de bienestar \HQQXHVWURVDGRUPHFLGRViQLPRV$XQVLWHQHPRVRQRXQDFRUD]DJUXHVDHVWHLQWHQWRGHGHVSHUWDUYHUJHQ]DHQ nosotros, debiera hacerse una y otra vez. +HUPDQQ3ROOLJGHO,QVWLWXWRGH5HODFLRQHV,QWHUQDFLRQDOHVHQ6WXWWJDUWHVXQRGHORVSRFRVTXHFXHQWDQFRQ el poder y las posibilidades de hacerlo, si bien no siempre con éxito. Nos muestra en sus salas Todesbilder>,PiJHQHV de la muerte], para darnos oportunidad de ver a la muerte en sus mil ojos, los que a través de cuadros, fotos, cajas-objeto y dibujos del “Grupo Chaclacayo”, Helmut Psotta, Sergio Zevallos y Raúl Avellaneda, dirigen su mirada hacia nosotros. (VDVtFRPRHO,QVWLWXWRGH5HODFLRQHV,QWHUQDFLRQDOHVHQYLVWDGHODVGHOLFDGDV´UHODFLRQHVµTXHWHQHPRVFRQ el exterior, si en el foro para el intercambio cultural se cambiara nuestra perturbada posición con respecto a la muerte, daría lugar a otra forma de ayuda al desarrollo. Así habló Hermann Pollig el día de la inauguración de la exposición sobre la muerte. De nuestra pulcra y reprimida forma de tratarla acá, y de la banal forma de ser tratada por los otros, sobre el proceder con relación a la misma y sobre las alternativas que la muerte nos brinda en la vida. Habló del “des-aburguesamiento” de la muerte y citó al sociólogo inglés Geoffrey Gorer, quien escogió “The Pornography of Death” [la pornografía de la muerte] como título para uno de sus ensayos. Sobre el “Death-Style” [estilo muerte] fue el discurso, así como sobre otros engendros de nuestras “imágenes” de la muerte. Hermann Pollig: “Entiendo como Todesbilder>,PiJHQHVGHODPXHUWH@ODVLQFyPRGDVLPiJHQHVTXHQRVRIUHFHQ Psotta, Zevallos y Avellaneda. Ellos ponen ante nuestros ojos una muerte que es tenebrosa, estridente y aterrorizante y es que la violencia, el terrorismo y la tortura también lo son. Sus fotos rompe-tabúes, dibujos y cajas-objeto, son trauPiWLFRVPDQLÀHVWRVFRQWUDODYLROHQFLDODEUXWDOLGDG\HOPLHGR(OVKRFNTXHGHVHQFDGHQDQHVWDVLPiJHQHVWUDQVSRQH con frecuencia las fronteras del dolor psíquico. Ellas provocan por su obsesión, su neurótica irracionalidad, su salvaje y expresiva blasfemia. Su difamadora resistencia objetiva no es otra que el resultado de un enfrentamiento psíquico y artístico con una sociedad que vive acostumbrada a la muerte violenta. Este arte es una resistencia potencial contra una realidad grave, y es profundamente moral”. Es así como el tema de la exposición es la violencia y la muerte. 8QJUXSRGHDUWLVWDVSHUXDQRVWUDWDGHGHPRVWUDUODDÀUPDFLyQFDGDYH]PiVGHEDWLGDTXHHODUWHSXHGHWHQHU un efecto social, según como se lo vea. La condición sería que lo que se entiende por arte, sus posibilidades de actuación, así como nuestras costumbres de recepción tuvieran otro tipo de conciencia para este tipo de residuos artísticos. De lo contrario, el esfuerzo de este tipo de grupos y artistas individuales no tendría resonancia y quedarían sin efecto, tanto para ellos como para nosotros. Se perdería entonces otra oportunidad de reclamar un arte apto para las mayorías. Si estos artistas se encierran en una clausura, si huyen de las fuerzas que los subyugan, es para desarrollar, a través de la distancia y el experimento, interrogándose y llegando a sus respuestas artísticas, una terapia para ellos y para esta sociedad que sufre lo inimaginable. Si nosotros tenemos la oportunidad de experimentar esta lucha, que no está exenta de peligro para la vida de los artistas, esta batalla por libertad, este ir contra la violencia, el terror y el miedo, en forma de imagen artística y en una exposición, se debería abrir paso la pregunta sobre cuánto potencial en humanidad, justicia y solidaridad tienen nuestros artistas, en su, en parte inaudita, disputa sobre la formulación de la vida en imágenes, si no se ven reacciones públicas. Sería deseable que en todos los lugares donde aún se presente la exposición en la 121 República Federal de Alemania, se hagan visibles las huellas de nuestros artistas, a medida que avanzan con ella, en señal de solidaridad con sus colegas latinoamericanos, apoyando su expresión de impotencia. En esta exposición se debería experimentar algo importante, si bien no tan bello, pero verdadero e inhumano. Cito a 3ROOLJ´9LVLWDQGRODPXHVWUDVHYHUiXVWHGHQIUHQWDGRDUDGLFDOHVSURFHVRVGHGHVPLWLÀFDFLyQFRQSURYRFDFLRQHV GLIDPDWRULDVWDE~HVURWRV/DFUX]PLWRVFULVWLDQRVPHWiIRUDV\ULWRVPLVWLÀFDFLRQHVHFOHVLiVWLFDVHtGRORVGHLGHQWLGDG como Santa Rosa de Lima son usados de igual manera que los símbolos de la violencia y la subordinación. Los símbolos sexuales no representan placer, son imágenes sensoriales de la violencia ejercida y sufrida”. La penosa búsqueda de formas de diálogo con uno mismo y con la sociedad (que nuestros artistas tanto buscan), vital para un artista, aquí en forma de augurio, se puede leer, ver y nos lleva a convivir la vida de los oprimidos. En conversaciones con los artistas se percibía continuamente el miedo de las consecuencias de esta exposición, que el regreso al Perú después de esta muestra no estará exento de problemas, sobre todo si es que no hay una reacción clara desde Europa hacia ella; si es que se les pudiera echar en cara que el interés en su lucha por el pueblo peruano no es importante para los europeos, que en Europa no se quiere saber ni ver. ¡Cuán cierto! Sergio Zevallos escribió bajo el título: “La muerte obscena / Perú 1982–1989 – El útero del mal para mi pintura.” (QHVWRVWLHPSRVVHUSHUXDQRVLJQLÀFDHQSULPHUOXJDUFUHFHUHQXQSDtVHQHOTXHODDPHQD]DFRQVWDQWHTXH GHWHUPLQDWRWDOPHQWHHOVHQWLGRGHODYLGDGHFDGDLQGLYLGXRHVXWLOL]DGDFRPRPpWRGRGHFRQWURORÀFLDOXQKHFKRTXH KDVWDDKRUDKDVLGRDFHSWDGRFRQUHVLJQDFLyQSRUODPD\RUtD3HURHVWRVLJQLÀFDWHQHUTXHVRSRUWDUGHVDUPDGRODGUiV tica decadencia moral de la sociedad, cuyas terribles consecuencias se traducen en poder asesinar, masacrar sin escrúSXORVLQFOXVLYHFRQOHJLWLPDFLyQSROtWLFD$FRVWXPEUDUVHDPXHUWHVEDQDOHVSODQLÀFDGDVFRQWRGDLQWHQVLyQRUHVXOWDGR GHHUURUHVLUULVRULRVTXHVHSXGLHURQHYLWDU«6RQWDQWDV\HQRUPHVODVDJUHVLRQHVFX\R~QLFRÀQHVLQYHUWLUHOVHQWLGR de la existencia en lo contrario. Esta es sencillamente una constatación objetiva e histórica: nosotros vivimos mezclados con la muerte en una promiscuidad mortal; la muerte nos obliga constantemente al consumo visual de cerros de cadáveres que se transforman en los actores principales de una grotesca “Tragedia humana”, exponiendo su incómoda presencia a nuestros aún más indecentes ojos -horripilante escenario de una vida corriente, delatados y desparecidos en este recorrido irracional de la historia. Una pesadilla de la vida real se forma de la pesadilla de una exposición. 122 Dorothee Hackenberg, “Dieser Brutälitat der Sanftheit. Interview mit Helmut J. Psotta, Raúl Avellaneda, Sergio Zevallos von der Grupo Chaclacayo über ‘Todesbilder’;” y “Heilige Folter-Rosa!,” taz, Berlín, 26 de enero de 1990, pp. 22-23. 123 124 125 “ESTA BRUTALIDAD DE LA SUAVIDAD” Entrevista con Helmut Psotta, Raúl Avellaneda y Sergio Zevallos del Grupo Chaclacayo sobre “Todesbilder” [Imágenes de la muerte] $OÀQDOGH&KDFODFD\RXQSHTXHxRSXHEORHQORV$QGHV\DFHD~QXQDFDVD2WURUDXQJHQHUDOSHUXDQRFHOHEUDEDDKt IDVWXRVDVÀHVWDV$KRUDODFDVDHVDOTXLODGDSRUHO,QVWLWXWR*RHWKHFRPRHVWXGLRSDUDXQJUXSRGHDUWLVWDV+HOPXW 3VRWWDTXLHQWUDEDMDFRPRSURIHVRULQYLWDGRHQOD)DFXOWDGGH$UWHGHOD8QLYHUVLGDG&DWyOLFDGHO3HU~VHKDUHWLUDGR HQPHGLRGHODVPRQWDxDVGHVLHUWDVFRQGRVGHVXVDOXPQRVSHUXDQRV6HUJLR=HYDOORV\5D~O$YHOODQHGD /RVUHVXOWDGRVDUWtVWLFRVGHGRVDxRVGHWUDEDMRLQFOX\HQGRSLQWXUDVLQVWDODFLRQHV\IRWRVGHSHUIRUPDQFHVUHDOL]DGDV HQORV$QGHVIXHURQH[KLELGDVHQHQHO0XVHRGH$UWHGH/LPDDQWHVTXHJUDFLDVDODFRODERUDFLyQGHOD (PEDMDGD$OHPDQDHO,QVWLWXWR*RHWKHHO3URJUDPDGH$UWLVWDVGH%HUOtQGHO'$$'\HO0LQLVWHULRGH5HODFLRQHV([WH ULRUHVGH%RQQVHORJUDUDTXHODPXHVWUDYLDMHD(XURSDKDFLDOD5HS~EOLFD)HGHUDO$OHPDQD/D~OWLPDHVWDFLyQ GHVSXpVGH6WXWWJDUW%RFKXP\.DUOVUXKHHV%HUOtQ taz: 7DO\FRPRXVWHGHVORKDQIRUPXODGR3HU~UHSUHVHQWDHO´ÀQGHOVXHxRHXURSHRµ¢6HKDOOHJDGRDOÀQGHOVXHxRHX URSHR\DVtDOÀQGHVXLQÁXHQFLD" Helmut Psotta: Para mí, como europeo, el Perú es un caso paradigmático de 500 años de colonización. 500 años de riqueza y siempre la violencia en nombre de una moral reinante o del cristianismo. Este saqueo, esta voluntad de dominación es para nosotros, los europeos, una mentalidad ya desarrollada. Lo vemos aún ahora en Berlín y en la República Federal Alemana (BDR): todo lo que se libera vuelve a ser ocupado, es el sueño del desplazamiento de territorios. Lo que DQWHVRFXUUtDDWUDYpVGHOD,JOHVLDDKRUDWLHQHOXJDUDWUDYpVGHORVEDQFRVRORVSROtWLFRVDXQTXHQDWXUDOPHQWHGHPRGR más sutil. Pero poco a poco nos vamos despertando desengañados, gracias a la realidad peruana. Raúl Avellaneda: El legado de la cultura europea en el Perú es completamente decadente: la gente más sencilla no tiene ni siquiera agua potable o luz eléctrica. Psotta: En Lima se encuentra San Marcos, la universidad más antigua fundada por los españoles en el continente americano. Yo siempre me había imaginado que al menos tendría una fachada aceptable. Sin embargo, lo que uno ve allí es una estación cancerígena, 60% de los estudiantes están mal nutridos. Se ha deteriorado notoriamente al punto de parecer la escena tras un bombardeo. No hay ni un centavo de subvención y el campus está tomado por la policía. Cuando en San Marcos se encuentra un libro de Marx o Marcuse, uno se ve inmediatamente torturado, desaparece o HVDVHVLQDGR(VWRHVVyORXQHMHPSORGHTXHHVWHÀQGHOVXHxRHXURSHRUHJLVWUDDOJRTXH0DU[SUREDEOHPHQWHQRVH hubiese podido ni imaginar. ¢$TXpVHUHÀHUHVXDXWRGHVFULSFLyQFRPR´HXURSHRVSURKLELGRVµ" Sergio Zevallos: Vivimos en un mundo dominado por normas europeas: la lengua, la ideología, la religión. “Prohibido” VLJQLÀFDTXHQRSRGHPRVFRQWLQXDUSRUHOPLVPRFDPLQR\DTXHQRVRWURVQRVHQFRQWUDPRVVRPHWLGRVSROtWLFDSVLFROy JLFD\HPRFLRQDOPHQWH8QRVLHQWHXQDQKHORSRUH[SUHVDUHVWDWHUULEOHVLWXDFLyQ\VyORDWUDYpVGHODLQÁXHQFLDGHXQ europeo es que se puede superar esta afasia. No existe otro camino, los caminos antiguos han quedado todos sepultados. Psotta: 1RVRWURVORVHXURSHRVGHEHPRVGHYROYHUOHVDTXHOORTXHOHVTXLWDPRVKDFHWLHPSRODFRQÀDQ]DHQVtPLVPRV La propaganda aquí hace de los sudamericanos especies exóticas y papagayos, pero el Perú es un país que fue territorio europeo, de eso se da uno cuenta a cada paso. Avellaneda: Pero nosotros ahora estamos hablando sobre arte, sobre intercambio humano. Políticamente todo es más complicado. Si ahora se hiciera en el Perú una revolución como la de Rumania [1989], no tendríamos casi ninguna cultura que se sostenga autónomamente, solo tenemos una lengua europea. Psotta: Es verdaderamente un círculo vicioso aterrador. Quizás uno pueda solucionar esto sólo psicológicamente, a nivel individual, del mismo modo que nosotros lo buscamos como grupo. 8VWHGHVWUDEDMDQHQVHULHVTXHYDQGHDWUDEDMRVFRUUHVSRQGLHQWHVDXQPLVPRWHPD¢(VWRVHGHEHDXQD E~VTXHGDSRUODVROXFLyQySWLPDRUHVSRQGHDXQKDFHUTXHORVRFXSDREVHVLYDPHQWH" Psotta: Es una obsesión. Goethe escribió: “Todavía no se decirlo, ya que mi palabra no ha sido aún hecha.”1 Uno está tan psíquicamente dominado por esto, que busca la forma de expresión más precisa. La esperanza de que en algún momento se encuentre una expresión válida para tanto escándalo, como una cerradura que se abre para un torrente de imágenes. Es una terapia. Pero claro, a esto le sigue un concepto de calidad. No es que uno vomite todo y de ahí lo cuelgue, sino que cuando lo hacemos público seleccionamos lo mejor. Y en ese sentido, todas juntas son obras de arte. ¢6HUtDSRVLEOHLPDJLQDUVHHQDOJ~QPRPHQWRRWURWHPDDGHPiVGH´7RGHVELOGHUµ>,PiJHQHVGHODPXHUWH@" Avellaneda: No para mí. Yo no puedo mentir o disimular algo. (VRVLJQLÀFDTXHODVFRQGLFLRQHVH[WHUQDVWHQGUtDQTXHFDPELDU6XFDVDHQ3HU~IXHLQVSHFFLRQDGD>SRUDJHQWHV SROLFLDOHV@HQPiVGHXQDRSRUWXQLGDG\DQRHVSRVLEOHDLVODUVHGHODUHDOLGDGVRFLDO Avellaneda: Tampoco podemos regresar más, ya que en el Perú somos perseguidos por la prensa y la policía. ¢>6RQSHUVHJXLGRV@GHVGHTXHVHUDGLFDURQHQHOH[WUDQMHUR" Psotta:,QFOXVLYHSHUVRQDVDFiKDQTXHULGRLQWHUURJDUDOGLUHFWRUGHOD.QVWOHUKDXV0LFKDHO+DHUGWHUVREUHQRVRWURV En revistas difamadoras en el Perú se aseveran las cosas más inimaginables, por ejemplo se dice que nosotros somos subversivos. Llegan tan lejos, hasta aseverar que las instituciones federales alemanas que apoyan el proyecto lo son también.2 La exhibición en Lima [en 1984] fue ya un enorme riesgo. Queríamos mostrar el trabajo en uno de los museos PiVJUDQGHVVyORH[LVWHQGRV\HVRVHORJUyJUDFLDVDODXVSLFLRGHO,QVWLWXWR*RHWKH(VWRIXHDQWHVGHODVHOHFFLRQHV y en ese entonces la subversión [por parte de “Sendero Luminoso” y otros grupos armados] no era aún tan activa. Hacerlo ahora sería imposible. En ese artículo difamador se decía: “De exponer estos chicos aquí, se les hubiese abierto un proceso.”3 En una situación tan cargada el arte funciona como un explosivo. /DH[SRVLFLyQHQ/LPDIXHVLQHPEDUJRDEVXUGDPHQWHFHQVXUDGDSRUSDUWHGHOODGRDOHPiQ¢4XpHVORTXHQROH FRQYHQFLyDORVDOHPDQHV" Psotta(O,QVWLWXWR*RHWKHWLHQHXQPDUFRGHDFFLyQGHWHUPLQDGR\HOGLUHFWRUGHWXUQRWLHQHTXHDFHSWDUFLHUWDVFRQGLciones de naturaleza política. Un embajador o agregado cultural tiene la posibilidad de imponer un veto. Ya entonces SROHPL]DED)-6WUDX‰TXHORV,QVWLWXWRV*RHWKHHVWDEDQPX\YLQFXODGRVFRQODL]TXLHUGDHWFpWHUD1XHVWURSUR\HFWRQR SUHWHQGtDWUDWDUODSROtWLFDH[WHULRUDOHPDQD)XHWDQEUXWDOFXDQGRHVWHDJUHJDGRFXOWXUDOHQWUyFRQXQOiSL]DÀODGR\GLMR que tal o cual cosa tenía que salir, que esto era pornografía. Pero esto no ocurrió con ninguno de mis trabajos, los alemanes no pueden censurar a un alemán en el Perú, pero sí a los peruanos. Entonces decidimos cubrir todo lo incriminado con paños negros, al ennegrecerlo todo seguimos la tradición de la censura, pero los paños fueron inmediatamente arranchados por el público. Nosotros ya sabíamos que esto iba a ocurrir. Lo absurdo fue que las autoridades peruanas no reaccionaron. E incluso el Ministerio de Relaciones Exteriores [de Alemania] ha tenido que escribir cartas de disculpas GHELGRDODVVRVSHFKDVOHYDQWDGDVSRUVXVUHSUHVHQWDQWHV\OXHJRKDQÀQDQFLDGR\WUDtGRODH[SRVLFLyQSDUDDFi Durante el transporte de las piezas hasta aquí, la Embajada Alemana volvió a colaborar. Todas estas son contradicciones bien extrañas, que inclusive pertenecen también al sueño europeo. ¢'HGyQGHSURYLHQHHVWDYLROHQWDUHDFFLyQGHODSUHQVDSHUXDQD" Avellaneda: Yo creo que la situación política se ha radicalizado totalmente. Pronto van a tener lugar las elecciones y naturalmente la extrema derecha quiere establecerse con [Mario] Vargas Llosa.4 Entonces esta exhibición, hecha por peruanos críticos y avalada por los alemanes, resulta naturalmente una enorme provocación. Zevallos: (Q%RFKXPXQFKHFR>QRVGLMRTXH@TXHUtDOOHYDUHVWDPXHVWUDD3UDJDSRUTXHVHQWtDXQDDÀQLGDGFRQHO movimiento social revolucionario. Sin embargo, tenía a la vez miedo de que la gente en Praga no la quisiera recibir, ya que cada uno tiene sus propios intereses. 126 127 ¢6RQORV´7RGHVELOGHUµ>,PiJHQHVGHODPXHUWH@PHWiIRUDVSHUIHFWDPHQWHH[SRUWDEOHVSDUDWRGRRVHUHÀHUHQHVSHFtÀ FDPHQWHDXQSUREOHPDPX\SHUXDQRODH[DJHUDGDIXVLyQGHOFDWROLFLVPRFRQODUHSUHVLyQSROtWLFD" representarla de modo evidente, de tal manera que es a la vez horrorosa y bella. Y la belleza no implica que por ello el tema de la muerte se vaya a ver mitigado. Psotta: Yo creo que esto es también un bien cultural europeo importado. Por ejemplo, Santa Rosa de Lima; ella realmente se laceró totalmente a los 31 años. Y ella fue precisamente elevada a un ideal, el ideal del sufrimiento hasta el último momento como penitencia, como necesidad absoluta para lograr la absolución. Todos cargamos estas Santa Rosas en QRVRWURV>/DWHyORJDFULVWLDQDDOHPDQD@8WD5DQNH+HLQHPDQQHVSHUVHJXLGDSRUOD,JOHVLDSRUGHFLUYHUGDGHVPX\VLPSOHV/RPLVPRRFXUUHFRQODJHQWHGHOD7HRUtDGHOD/LEHUDFLyQODFXDOHVVLPSOHPHQWHH[FRPXOJDGD/D,JOHVLD&DWyOLFD QXQFDIXHWDQUHDFFLRQDULDFRPRORHVDKRUD(O>3DSD.DURO-yVHI@:RMW\OD>-XDQ3DEOR,,@SRGUtDVHUHOUHSUHVHQWDQWH GHXQDFRPSDxtDGHTXtPLFRVpOSHUVRQLÀFDLQFUHtEOHPHQWHHVWDEUXWDOLGDGGHODVXDYLGDG3RURWURODGRHOJUDGRGH disposición al sufrimiento que hay en el Perú, consolado por una creencia en el más allá, es inimaginable. De ahí también ODDSDULFLyQGHXQD6DQWD5RVD\HOLGHDOGHODDXWRÁDJHODFLyQ Zevallos: (VRLPSOLFDWDPELpQXQUHVSHWRSURIXQGRIUHQWHDOPDWHULDODOPHGLRHVWRVLJQLÀFDDVXYH]UHVSHWRDODV personas... TXHQRH[LVWHHQHOFRQWH[WRVRFLRSROtWLFRUHDO Zevallos: Yo también tengo que tratar con objetos que me producen asco ya que conozco su historia. Tengo que hacerme consciente de ellos y dejarme poseer por la esencia de esos objetos, de tal manera que los trate como a personas. ¢(QTXpPHGLGDKDQVXFXPELGRXVWHGHVDLPiJHQHVURPiQWLFDVDORVWRSRVRFFLGHQWDOHVGHXQDDxRUDQ]DDODPXHUWH FRPRHQ(OUH\GHORVHOIRV/DPXHUWH\ODGRQFHOODHWF" Avellaneda: O de Cristo, siempre representado como un cadáver. Cuanto más heridas, mejor. Zevallos: Justo habíamos pensado incluir esas canciones. Psotta: Como un mapa de heridas. Y esas esculturas de madera totalmente corroídas son todas europeizadas, incluso llevan pelucas rubias europeas. Para eso sí está el dinero, para iluminar una iglesia decorativamente, mientras al lado hay franjas de desierto donde la gente no tiene agua o vivienda. ¢<ODJHQWHFUHHHQHVR" Avellaneda: Ellos buscan algo de lo cual poder colgar su alma. Por ejemplo, la procesión del Señor de los Milagros. Masas de gente se mueven por las calles, se quejan y gimotean del mismo modo desde hace cientos de años. :LHODQG6FKPLHGHVFULELyTXHOD,JOHVLDKDFXELHUWRGHYHUJHQ]DWRGRHOFDPSRVH[XDO\SRUORWDQWRHOiPELWRGHOD YLROHQFLDVHKDYXHOWRQHXWUDO6HUJLRKDEODHQXQHQVD\RVREUHODGHVYHUJHQ]DGHODVHVLQDWRFRWLGLDQRGHOD´PXHUWH REVFHQDµ Zevallos: Arriba se ubica el poder con la cara limpia cuando en realidad comete delitos. Abajo todo se sabe, se conoce a los delincuentes por nombre, pero sin embargo no se hace nada, se viven relaciones humanas muy normales. Eso es esquizofrenia. Psotta: /RFXUDPHWyGLFD8Q0LQLVWURGHO,QWHULRUOHGLVSDUDSHUVRQDOPHQWHDSUHVRVSROtWLFRV\DOGtDVLJXLHQWHVHDUURGLOODFRQWUDMHOLPSLRDOODGRGHO3DSD>-XDQ3DEOR,,@3DUDHVWDYLVLWDVHGHFRUyXQFHQWURFRPHUFLDOLPLWDQGRXQDIRUWD OH]D,QFD\HOPLQLVWURGHVSRVySUHYLDPHQWHDVXVHxRUDUHOLJLRVDPHQWH\DTXHVHGLFHHQXQHVWDWXWRTXHXQRQRSXHGH recibir a un Papa con su concubina. Avellaneda: Y esta gente pretende saber qué es pornografía. (QPXFKDVDFFLRQHVXVWHGHVMXHJDQFRQODÀJXUDGHGLJQDWDULRVHFOHVLiVWLFRV\FRQORVULWRVFDWyOLFRVSRUHMHPSORFRQ HO9LHUQHV6DQWR Psotta: ¿Pero dónde ves tú lo romántico en nosotros? Es más bien siempre sátira. A veces cinismo. Avellaneda: Se mantiene siempre al borde de la belleza, uno tiene que agregarle un poco de fealdad, entonces se le da la vuelta. ¢4XpVLJQLÀFDGRWLHQHSDUDXVWHGHVHONLWVFKFRPRPRGHORHQVXWUDEDMR" Avellaneda: Nosotros tomamos lo que encontramos: muñecas abandonadas, pequeñas imágenes religiosas tiradas en la calle, e incluso imágenes de tortura tomadas de la prensa. Muchas de estas imágenes se encuentran tan internalizaGDVHQODSREODFLyQTXHORVPRWLYRVFOiVLFRVVHYHQÀOWUDGRVQXHYDPHQWHSRUHMHPSOR-HV~VFRQFDEHOORUXELR\RMRV D]XOHV\IUHQWHDHVWDVLPiJHQHVODJHQWHHQFLHQGHYHODV/DVSHTXHxDVÀJXUDVGH0DUtD\-HV~VQRGHEHQVHUWLUDGDV DODEDVXUDVLQRPiVELHQVHUOOHYDGDVDOFHPHQWHULR$KtSXHGHVYHUPLOHVGHYHUVLRQHVGHSHTXHxDVHÀJLHVGH-HV~V\ María, sin cabeza, quemadas. Este es por cierto un negocio importante en el Perú: la venta de esas pequeñas imágenes. NOTAS 1 Traducción literal de la paráfrasis de Psotta. No se ha podido encontrar la cita original referida. Nota de la traductora. 6HUHÀHUHDODUWtFXORGH/XLV/DPD Véase Luis Lama, “Perversión y complacencia,” Caretas, Lima, 20 de noviembre de 1989, pp. 74 -76. Nota del editor. 3 La frase textual del artículo dice: “Quizás los muchachos han hecho bien en no presentar aquí su versión de la violencia peruana ‘For Export’, porque se hubieran ido al descalabro.” Luis Lama, “Perversión y complacencia,” p. 76. Nota del editor. 4 El escritor Mario Vargas Llosa –ganador del Premio Nobel de Literatura en 2010– fue candidato a la presidencia del Perú en 1990 con la alianza política liberal y conservadora de centro-derecha Frente Democrático (Fredemo). En esas elecciones Vargas Llosa perdió contra Alberto Fujimori, quien en 1992, a través de un auto-golpe, convertiría su gobierno en una dictadura que duró hasta el año 2000. Nota del editor. Psotta: Toda la liturgia de Viernes Santo es un verdadero drama, una forma de teatro que me fascinó desde niño. Cómo el morirse es dramatizado y cómo se puede sufrir tremendamente, resistir a la muerte, convertirla en metáfora. Avellaneda: (VWDIDVFLQDFLyQWLHQHPXFKRTXHYHUFRQWHUQXUDFRQKXPDQLGDG7UDWDUHVWDWHPiWLFDQRVLJQLÀFDOOHYDU la violencia en uno mismo. Por ejemplo, la manera en la que Helmut colocaba los paños para construir un vestido en la performance, esa atmósfera tranquila. O quizás también, como dice Leonardo, lo más bello se vuelve aún más bello, FXDQGRHVWiUHÁHMDGRHQORPiVIHR ,QFOXVLYHHQORV´7RGHVELOGHUµ>,PiJHQHVGHODPXHUWH@H[LVWHXQDE~VTXHGDGHODEHOOH]D Psotta: /DEHOOH]DHVWDPELpQXQDSURWHFFLyQ3DUDSRGHUVRSRUWDUHOFRQÁLFWREXVFRXQDIRUPDTXHFDXVHGHOHLWH un equilibrio al menos. Los accionistas vieneses dejaban correr verdadera sangre, en nuestro caso es sangre de teatro, ÀFFLyQ&XDQGRVHWLHQHODVXÀFLHQWHFRQH[LyQHVSLULWXDOFRQODWHPiWLFD\ODSRWHQFLDDUWtVWLFDQHFHVDULDXQRSXHGH ¡SANTA TORTURA ROSA! Performance y puesta en escena nacional de un símbolo peruano Una capilla fecunda de catolicismo y elevada hacia lo surreal; sobre el altar cuelga un fardo (¿un cadáver?) pintado de rojo en medio de los llamativos y sonrientes retratos de un general peruano. Sobre los escalones, un ramo de claveles rojos higiénicamente cubiertos en plástico, y sobre el suelo la bandera del Perú: largos paños procesionales en rojo, negro y blanco. Para aquellos que observaban la performanceGHVGHODJDOHUtDGHODFDSLOOD>GHO.QVWOHUKDXV%HWKDQLHQ@HQ primer plano se ha dispuesto un ancho ataúd, un armatoste conteniendo los miembros entumecidos de un hombre y una mujer, un deshecho de paja, tela y otros materiales cotidianos, reliquias de una acción previa. Con mucha naturalidad intervienen los visitantes en esta instalación de una violación, bebiendo dos de los vasos de vino llenos de un líquido color rojo sangre. ¿No podrían haber contenido sangre de verdad en su interior? Por largo tiempo nada se mueve en el 128 129 escenario, hasta que poco a poco se empieza a dar uso a todos los accesorios: la víctima desnuda abotona la camisa del asesino, y es a continuación atada por éste a una silla frente al altar, sus piernas son lavadas con un líquido color rojo sangre, una corona de rosas se le ata a los rizos de cabello, y aunque muy grande para la cara del cadáver, no lo es para la máscara blanca de amplia sonrisa y boca abierta, en la que juega una lujuriosa lengua. La performance juega con un leitmotiv recurrente del Grupo Chaclacayo: el culto a Santa Rosa de Lima. La santa patrona peruana -a veces representada con el ancla y el niño Jesús, pero siempre con una corona de rosas atada al velo de monja- era una joven muchacha indígena1 quien con asco dio la espalda al libertinaje espiritual y terrenal de las FODVHVDOWDVOLPHxDVGHORVVLJORV;9,\;9,,\GHVIRJyWRGRVVXVGHVHRVHUyWLFRVDWUDYpVGHODDGRUDFLyQH[WiWLFDGHO salvador católico, a través del deseo de muerte y la auto mutilación del cuerpo. Ella, quien de comprobable belleza se negó a los hombres hasta su muerte temprana, fue posteriormente profanada y violada: no sólo fueron sus miembros destrozados por las masas durante su funeral, sino que según el artista H. J. Psotta, su imagen cuelga hoy en todas las estaciones de policía en las que se interroga y tortura. Para el 400 aniversario de su nacimiento, el presidente Alan García Pérez le otorgó la distinción más prestigiosa de la nación, “La Orden del Sol”, en presencia de los más altos rangos militares, de la policía, del nuncio apostólico y los obispos; como a Willy Brandt, tan sólo 4 días después de la ejecución masiva de presos políticos por parte de grupos del gobierno. 6DQWD5RVDGH/LPDWXYRTXHDEDQGRQDUVXYHUGDGHUDLGHQWLGDGSDUDSRGHUFRQYHUWLUVHHQODÀJXUDLUUDFLRQDO de culto de la casta clerical fascista en el poder. En la europeizada tradición pictórica peruana, su piel se representaba FDGDYH]PiVEODQFD\VXVFDUDFWHUtVWLFDVHUDQFDGDYH]PiVNLWVFK6XSDVLRQDOUHFKD]RDODPRUWHUUHQDOVHWRUQyHQ sujeción lasciva y, mientras la mística en “Santa Teresa [de Avila]” del [escultor y pintor italiano Gian Lorenzo] Bernini es representada en éxtasis activo, domina en la representación adaptada de la “Santa Rosa” del [escultor italiano] Melchiorre Caffa el exhibicionismo sin disfraz de un ser sin voluntad. Hoy Santa Rosa -quien, como se menciona en un Léxico de Santos ’alemanes‘, mostró tanto autocontrol que no emitió ningún ruido tras la amputación de uno de sus dedos- es la santa patrona de los heridos, las parturientas y las desavenencias familiares... Es decir, el purgante perfecto para los efectos secundarios de la tortura, la violación y la muerte. Para todos los otros casos tienen los peruanos de hoy un pozo, en el cual según la leyenda, Santa Rosa como “sadomasoquista ejemplar, echa la llave de su cinturón de castidad” y en el que siglos después “vuelcan sus más secretos deseos los limeños de corazón devoto”, tal y como lo formula el sociólogo citado por H. J. Psotta, Sebastián Gris. “Combinadas en su imagen sacra, tortura y represión sexual operan una compleja síntesis de nuestra sicología urbana. La otra cara, el cuerpo otro y negado de Santa Rosa es sin duda la Perricholi, extremos que derivan de una misma actitud represiva. (...) Pero Santa Rosa como parte y síntoma de un orden dado es también acá el elemento catártico que permite al artista un develamiento extremo y, eventualmente, un cuestionamiento mayor.”2 Ciclos de 50 y más trabajos sobre un mismo tema son la expresión de esta búsqueda de catarsis, la necesidad de redención de un sujeto, que no se rinde. En la performance se potencian mutuamente pintura, telas, cuerpos, DUGLHQWHVDULDVGHO$YH0DUtDYHORVÁRUHVSDxRVURMRVKDVWDHOOtPLWHGHODWROHUDELOLGDGSVtTXLFDH[WHQGLGRVUHSHWLWL vamente en el tiempo. No hay ninguna provocación dirigida a los espectadores, más bien una necesidad compulsiva, el tratamiento de un trauma. La desnudez no es entendida como un espectáculo YR\HXUtVWLFR, sino más bien como predestinación, como consagración hacia la muerte. En silencioso consentimiento, pero sin acuerdo previo, el grupo consuma todos los pasos necesarios para un ritual improvisado. La víctima es colocada en repetidas ocasiones en la pose adecuada, con la corona de espinas de rosa al cuello, profanada, herida; fornica con la silla colocada boca abajo sobre el piso y es cuidadosamente decorada con serpentinas, mientras la máscara blanca peruana de sonrisa irónica decora una cruz. Los FRMLQHVSOiVWLFRVHQIRUPDGHFRUD]RQHVFRORUURVDTXHOOHYDQODLQVFULSFLyQ´,FKOLHEH'LFKµ ´<RWHDPRµ VRQLQÁDGRV cuidadosamente, las cenizas son dispersadas sobre los velos y los paños son plegados con devoción: ritos funerarios. NOTAS 1 Santa Rosa era mestiza, no indígena. Nota del editor. 2 Ambas citas del autor Sebastian Gris (seudónimo del crítico Gustavo Buntinx), han sido extraídas literalmente del original en español. Véase Sebastián Gris, “Una experiencia extrema en nuestro arte,” El Caballo Rojo, Lima, 28 de agosto de 1983, pp. 10-11. Nota del editor. Michael Nungesser, “Gebärmutter des Bösen: Die peruanische Gruppe Chaclacayo im Künstlerhaus Bethanien,” [Periódico no identificado], Berlín, 6 de febrero de 1990, p. 5. EL ÚTERO DEL MAL El grupo peruano Chaclacayo en el Künstlerhaus Bethanien Creencias y supersticiones, opresión y explotación, violencia y desesperación, representan el complejo marco temático existencial que procesa con expresividad apasionada el grupo peruano Chaclacayo en su trabajo artístico comunitario. La vida y el trabajo de los tres artistas se fusiona al igual que los niveles estéticos del dibujo, la acción, la performance y la instalación. El artista alemán de origen judío, Helmut J. Psotta, quien enseñó en Lima en la Escuela de Arte [de la Universidad Católica del Perú], y sus dos alumnos, Raúl Avellaneda y Sergio Zevallos, se retiraron a principios de los años ochenta a las afueras del pueblo andino de Chaclacayo donde vivieron y realizaron su propuesta artística. (QODH[SRVLFLyQHQHO.QVWOHUKDXV%HWKDQLHQVHSUHVHQWDQGRFXPHQWDFLRQHVIRWRJUiÀFDVGHODVDFFLRQHVGH ORVWUHVDUWLVWDVTXHMXQWRFRQWUDEDMRVRULJLQDOHV\REMHWRVUHSUHVHQWDQXQDREUDPDFDEUD\DOPLVPRWLHPSRGHVPLWLÀcadora. Para comprender este trabajo comunitario extenso -que se radicaliza más por la reclusión- hay que entender la FRQTXLVWDGHOLPSHULR,QFDSRUORVHVSDxROHVTXHFRQWLQ~DGHMDQGRUDVWURVVDQJULHQWRVGHYLROHQFLDKDVWDHOSUHVHQWH En los últimos años miles de personas, en especial las poblaciones indígenas, han sido torturadas y asesinadas por razones políticas, sin que estas acciones hayan sido procesadas por la justicia. (Q´,PiJHQHVGHODPXHUWHµGHO*UXSR&KDFODFD\RVHHQFXHQWUDQGHPDQHUDFRQVFLHQWHPHQWHSURYRFDWLYD a menudo blasfema, representaciones simbólico-ceremoniales en las que el nacimiento, la muerte, el amor, el odio, la sexualidad, en formas predominantemente surrealistas, se desnaturalizan en rojo y negro. Las acciones del grupo VHUHDOL]DURQHQFHOGDVGHSULVLyQHQFHPHQWHULRV\HQODFDOOH\UHÁHMDURQORVULWXDOHVIXQHUDULRVGHODOLWXUJLDFDWyOLFD URPDQDODOLWXUJLDGHOYLHUQHVVDQWR\HOPLWR\GRJPDGHOD´,QPDFXODGD&RQFHSFLyQµRLPSURYLVDURQVREUHODV “Pasiones de un cuerpo ambulante” -una versión obscena de la danza macabra, realizada por Zevallos en su natal Lima, “el útero del mal materializado.” El trabajo del grupo no está en peligro. En 1987, policías estatales fuertemente armados penetraron su refugio GHELGRDODVRVSHFKDGHDFFLRQHV´SHQDOHVRFULPLQDOHVµ'HVSXpVGHUHFWLÀFDUHOHUURUVHLQFOX\yDORVRÀFLDOHVHQ uniforme y con ametralladora en una performance -las fotos son escalofriantes. “Perú... un sueño” se denominó al espectáculo: una amarga, trágica ironía. 130 Michael Haerdter, “Todesbilder: Peru oder Das Ende des europäischer Traums,” manuscrito inédito preparado para la apertura de la exposición Todesbilder, Zentrum für Kunstausstellungen der DDR. Galerie am Weidendamm, Berlin, mayo de 1990. IMÁGENES DE LA MUERTE: PERÚ O EL FINAL DEL SUEÑO EUROPEO Tres artistas han invitado a una amplia retrospectiva. El alemán Helmut J. Psotta y sus estudiantes y colegas peruanos Raúl Avellaneda y Sergio Zevallos se retiraron por algunos años a la soledad de un valle en los Andes del Perú, en el pueblo de Chaclacayo, para dedicarse completamente a su trabajo. De ese lugar deriva el nombre del grupo. (VWDFROHFFLyQGHGLEXMRVREMHWRVLQVWDODFLRQHVPRQWDMHV\GRFXPHQWRVLGHQWLÀFDDORVDUWLVWDVFRPRXQJUXSR el Grupo Chaclacayo –cuyas obras surgen de una interacción íntima de sus miembros. Entre 1989-1990, tras su partida GHO3HU~ORVDUWLVWDVUHWRPDURQVXWUDEDMRDUWtVWLFRHQOD.QVWOHUKDXV%HWKDQLHQ%HUOtQ\SRVWHULRUPHQWHHQ$OHPDQLD Occidental. 1XHVWUDH[SRVLFLyQPDUFDXQDLQFLVLyQFDVLDUELWUDULDGHQWURGHXQ´ZRUNLQSURJUHVVµ'RFXPHQWDGHXQDPDQHUD expresiva la compulsión de trabajar, la productividad para la auto-liberación que son características del grupo. /DV´,PiJHQHVGHODPXHUWHµFRQVWLWX\HQXQ´PXVHRGHREVHVLRQHVµ'LFKDH[SUHVLyQHVSUHFLVD6HUHÀHUHVREUH todo a la obsesión de los artistas por sus mitos, recuerdos, emociones, miedos, revueltas y rituales individuales, pero también a la obsesión de Europa por América Latina, su ocupación a través de la historia europea y a la violencia. Las realidades internas y externas mezcladas se unen en una inextricable totalidad, que -en breve- es arte. Aquí se encuentra HOVHFUHWRGHVXHÀFDFLD El arte no se lee como un libro de divulgación o como un editorial. Sin embargo está permitido seleccionar y señalar algunas hebras de la maraña artística, de modo que ésta sea legible: Ahí está la violencia, que como un leitmotiv impregna todo el trabajo de los artistas. La violencia como un patrimonio de la humanidad desde la expulsión del Paraíso, Caín contra Abel, engendrada continuamente en todos los pueblos y países hasta el presente, objeto de nuestros noticieros diarios. Violencia contra disidentes, ortodoxos, violencia por miedo, codicia, placer sexual, ignorancia y desamparo, violencia del hombre contra si mismo. Y una y otra vez más: violencia y sexualidad, sexo ilícito que se convierte en violencia, odio y violencia como arquetipos encarnados en la estructura de los impulsos de la humanidad, su eterna maldición, violencia que -sólo oculta y reprimida– domina incluso nuestras sociedades ilustradas... la violencia también como destino individual de los artistas de Chaclacayo: los peruanos están familiarizados con el terror desde su infancia. Esta es la motivación del amor: el deseo de unión y realización, manifestados en el personaje simbólico de Santa Rosa de Lima. En la corrupta Lima de los conquistadores españoles, vivió hace 400 años la bella mestiza de piel oscura la locura de la rebelión como la esposa de Cristo, hasta que su joven vida se apagó bajo la violencia ejercida hacia sí PLVPD&RPREODQFDHVWDWXDGHPiUPROGHVOXPEUDQWHVHLQFRUSRUyÀQDOPHQWHHQHOFLHORGHORVVDQWRVURPDQRVXQ destino colonial. También la madre de Psotta se llamaba Rosa, una confusa coincidencia… Este es el paradigma del Perú: una tierra hermosa, rica, que pertenece también a uno de los países más infelices EDMRHOVRO/DVRPEUDPtWLFDGHORVSRGHURVRV\YLROHQWRV,QFDVHORURGHO&X]FRODSODWDGH3RWRVtHFOLSVDGRVSRUOD prepotencia y la brutalidad de los conquistadores, desde el antiguo círculo vicioso de la opresión y la explotación que hasta hoy no se ha quebrado. Patria Perú, deseada y temida, amada y odiada, donde luz y sombra se combinan con el deseo, para contribuir con la salvación de su pueblo del inferno y del purgatorio. El Perú y su destino se convierten en el centro gravitacional natural del trabajo individual y colectivo de los artistas de Chaclacayo. (OGHVWLQRGHO3HU~WDPELpQVLJQLÀFD(XURSD$OLJXDOTXHXQDOXSDDTXtODKLVWRULDHXURSHDVHKDFHOHJLEOHGH una manera ejemplar. En las propias vidas de los europeos “prohibidos” Zevallos y Avellaneda. Para el “legítimo” europeo Psotta en la parábola peruana del Holocausto europeo, del cual se escapó su familia judía... Consideremos uno de los hilos de este complejo universo de las “imágenes de la muerte”: el elemento ritual. El ritual se convierte en una armadura y un remedio para los débiles. Después de comprender la amenaza de muerte \HOPDOHQODSHUVRQLÀFDFLyQGHOWHUURUSXHGHGRPHVWLFDUODYLROHQFLDSDUDVtPLVPR\GHVDÀDUDODELVPR Acción y performance son, por lo tanto, componentes integrales del auto-conocimiento artístico y de la auto-liberación del grupo de Chaclacayo. Sus performances se convierten en una versión moderna de los ritos de evocación mítica de las danzas de muerte, las danzas macabras desde el comienzo de la humanidad. A nosotros, como ciudadanos de un país industrial altamente desarrollado ya la simple muerte, especialmente QXHVWUDSURSLDPRUWDOLGDGVLJQLÀFDXQWDE~&XDQGRODHVSHUDQ]DGHODVXSHUDFLyQWHFQROyJLFDGHODPXHUWHQRVH cumple, buscamos refugio en su negación total. $TXtODDÁXHQFLDGHODVLPiJHQHVGHORVDUWLVWDVGH&KDFODFD\RFKRFDFRQQXHVWUDVHQVLELOLGDGWDOYH]HQHOSXQWR más débil. Nosotros los europeos somos aquí los vulnerables, mientras que la muerte en las sociedades latinoamerica- 131 nas siempre ha sido un fenómeno público.Y no sólo en el sentido del mal, por ejemplo, cuando pensamos en el poder poético del tango del río de La Plata y sus canciones. (QVXREVHVLyQSRUGHVPLWLÀFDU\URPSHUQXHVWURVWDE~HV\UHSUHVLRQHVORVDUWLVWDVQRVHQIUHQWDQFRQODYHUGDG dolorosa en la habitación prohibida de nuestra alma. Además, los artistas rompen tabúes en otros aspectos. Se habla de ciertas paráfrasis postmodernas de la modernidad, las que en nuestros lares se convierten cada vez más en la jerga internacional de las elegantes escenas y mercados de arte, y tienen una fuerte tendencia a asumir la tarea de la decoración de interiores en nuestras sociedades de la división laboral. El expresionismo barroco, el pathos explosivo de los tres de Chaclacayo está fuera de este “internacionalismo sin rostro”, para decirlo con las palabras de Klaus Honnef. (QODV´,PiJHQHVGHODPXHUWHµWDOYH]GHXQDPDQHUDLQJHQXDVLQGXGDGHXQDPDQHUD~QLFDODpWLFDYXHOYH al punto de la mera estética. Aquí se encuentran antiguas fuerzas de trabajo como la ilustración, la acusación, la rebeOLyQHQÀQ²HVWD´IXHU]DGHODQHJDFLyQµTXHXQDYH]HUDODFDUDFWHUtVWLFDPiVGLVWLQJXLGDGHODPRGHUQLGDG 6LYROYHPRVDUHXQLUODVGLVWLQWRVFRUULHQWHV\PRWLYRVGHODV´,PiJHQHVGHODPXHUWHµHQXQDXQLGDGFRPSOHMD el siguiente mensaje adquiere su efecto sugerente: un período establecido de la “historia universal de Europa” ha llegado DVXÀQ7HQHPRVTXHEXVFDUXQQXHYRFRPLHQ]R *** (VWHWH[WRIXHUHGDFWDGRFRQRFDVLyQGHODLQDXJXUDFLyQGHODH[SRVLFLyQ´,PiJHQHVGHODPXHUWHµHQ.QVWOHUKDXV Bethanien, Berlín, por su director, el Dr. Michael Haerdter. /DH[SRVLFLyQLWLQHUDQWH´,PiJHQHVGHODPXHUWH3HU~RHOÀQDOGHOVXHxRHXURSHRµFRQREUDVGHO*UXSR &KDFODFD\R3HU~+HOPXW-3VRWWD6HUJLR=HYDOORV5D~O$YHOODQHGDVXUJLyDUDt]GHODSURSXHVWDGHO.QVWOHUKDXV Bethanien. Ha sido expuesta en Lima, Stuttgart, Bochum, Karlsruhe, Berlin Occidental. En la RDA la exhibición se presenta del 9 al 27 de mayo de 1990 en la Galerie am Weidendamm, Berlín, y del 17 de agosto al 30 de octubre 1990 en el Monasterio de Predicadores en Erfurt. (OSUR\HFWR´,PiJHQHVGHODPXHUWHµGHO*UXSR&KDFODFD\RVHGHVDUUROOyHQWUHHQHO3HU~,QFOX\H dibujos, objetos, esculturas, performances, documentaciones. Los resultados de los ciclos de trabajo resultaron en una presentación general de medidas extraordinarias y de grandes dimensiones espaciales. Por lo tanto, en esta exposición se presenta sólo una selección limitada que compila los diferentes períodos de trabajo. Las performances de los artistas de Chaclacayo tienen lugar el 24 y el 25 de mayo 1990 en el escenario del HVWXGLRGHO7HDWUR0D[LP*RUNLDSDUWLUGHODVKRUDV KRUDULRH[WHQGLGR  132 Joseph B. Adolph, “H.J. Psotta: Todo y/o nada,” in Lima Kurier. El mensajero de Lima, Lima, n. 25 (July, 1982), pp. 1-3. )RXUNH\WH[WVFRXOGQRWEHLQFOXGHGLQWKLVVHFWLRQEHFDXVHWKH reprint permission from the authors was not granted: Buntinx, Gustavo [Sebastián Gris]. “Una experiencia extrema en nuestro arte.” El Caballo Rojo, suplement of El Diario de Marka. Lima, 28 March, 1983, pp. 10- 11; “Grupo Chaclacayo. Los cuerpos del delito.” La República, Lima, 9 December, 1984, p. 49. Lama, Luis E. “Perversión y complacencia.” Caretas, Lima, 20 November, 1989, pp. 74-76; “Pobre Goethe.” Caretas, Lima, 3 December, 1984, pp. 62- 63. H.J. PSOTTA: ALL AND/OR NOTHING 2QKHUGHDWKEHGGertrude Stein³WKHJUHDW86ZULWHUDQG UHQRYDWRURUUHGLVFRYHUHURIODQJXDJH³DVNHGKHUORQJWLPH partner$OLFH%7RNODV´6R$OLFHZKDWLVWKHDQVZHU"µ In response to her companion’s silence, Gertrude insisted, ´,QWKDWFDVHZKDWLVWKHTXHVWLRQ"µ7DONLQJDERXWDUW teaching (but also much more than that), Helmuth J. PsottaYLVLWLQJSURIHVVRUDWWKH8QLYHUVLGDG&DWyOLFDLQ /LPDD*HUPDQFLWL]HQRI3ROLVKGHVFHQWZKRUHVLGHVLQ +ROODQGVD\VLQWKHLQWHUYLHZKHJUDQWHGWRWKH/,0$ .85,(5WKDW´JRRGWHDFKLQJLVDOZD\VDERXWDVNLQJDQG UHFHLYLQJTXHVWLRQVQRWDQVZHUV«7KHTXDOLW\RIWKH TXHVWLRQLVZKDWXOWLPDWHO\GHWHUPLQHVWKHTXDOLW\RIWKH DQVZHU«µ$VZHZLOOVHH3VRWWD·VDQVZHUVWRWKHXQLYHUVH DUHPXOWLGLPHQVLRQDOTXHVWLRQV LIMA KURIER: ,Q\RXUFODVVHVDQGZRUNVKRSVDWWKH >8QLYHVLGDG@&DWyOLFDKRZGR\RXDSSO\\RXUWRWDOL]LQJ FRQFHSWLRQRIWKHDUWLVWLFH[SHULHQFH" H.J. PSOTTA: The external or material prerequisites for thoroughly discussing and studying some of the most important aspects of my didactic ideas exist. Among the students, there is even a clear necessity —sometimes a WUXHKXQJHU³IRUWKHSRWHQWLDOPDWHULDOV,FRXOGRIIHUWKHP ,DPFRQVWDQWO\GLVFRYHULQJWKLVLQWKHLUH[WUDRUGLQDULO\ FRPPLWWHGUHDFWLRQVDQGWKHLUHPRWLRQDOVLQFHULW\,Q practice, all of this may be materialized in a very limited, VXJJHVWHGRUUHODWLYHO\XQLQWHQVHIRUP,QHHGHGPXFK PRUHWLPHWRRYHUFRPHWKHQDWXUDOGLIÀFXOWLHVHQFRXQWHUHG DWWKHEHJLQQLQJ WKLQNDERXWWKHSV\FKRORJLFDOHIIHFWV FDXVHGE\P\SHUVRQDRQHDFKVWXGHQW QRRQHNQRZVPH RUVKRXOG,VD\P\UHDOLW\ DQG,GRQ·WNQRZDQ\RQHEH\RQG WKHLULQHYLWDEOHVRFLDOPDVN7LPHDQGHQHUJ\DUHQHHGHG just for this inert process of the change and adaptation of our different sensibilities (not mentalities). Furthermore, due to my physical morphology and my temperament, ZKLFKLVDQ\WKLQJEXWSDVVLYH,DPDOZD\VWHPSWHGWRZRUN as effectively and with as much concentration as possible, DQGGHPDQGWKHVDPHIURPRWKHUVWKDWLVWRZRUNDVIDVW and as slow as necessary and possible… Personal and DFDGHPLFIUHHGRPZKLFK,KDYHH[SHULHQFHGDVDQHVSHcially pleasant circumstance at the [Universidad] Católica, WKXVDOZD\VFRQWLQXHVWREHUHODWLYHLI,WKLQNDERXWZKDW ,FRXOGGRZLWKWKHPDWHULDODYDLODEOH7KHUHIRUHDVLQDOO VXFKLQVWLWXWLRQVZHDUHGHDOLQJZLWKWKHXQGHÀQHGIUHHdom of the subjunctive… LK: <RXDUHD´PDQZKRSOD\VµDKRPROXGHQV+RZGR \RXDSSO\WKHREMHFWLYHÀQGLQJVRI\RXUDHVWKHWLFLQYHVWL JDWLRQVLQ\RXUWHDFKLQJ" HJP: This is only contradictory in appearance, since, as in all dialectical situations, one does not exclude the other, EXWLQVWHDGFRQÀUPVLW WKHUHVXOWRIDQH[SHULPHQWLVQHYHU PRUHLPSRUWDQWWKDQWKHH[SHULPHQWLWVHOI «,ÀQGHomo sapiens spontaneously suspicious, which will not surprise DQ\RQHZKROLYHVZLWKDQRSHQKHDUWQRZDGD\V,·YHMXVW read a beautiful thought by Miguel Hernández in one of his SRHPV´,ZRNHXSIURPEHLQJDER\QHYHUZDNHXS6DG LVP\PRXWKODXJKDOZD\Vµ«,QRWKHUZRUGV,UHDGWKLVDV ,GRQ·WMXVWZDQWWRSOD\ZLWKWKLQJVEXWRQWKHFRQWUDU\ ,OHWP\VHOIEHSOD\HGZLWKZLWKRXWIHDULQJWKLQJVZKLFKLV PXFKPXFKPRUHLPSRUWDQW«7KDWLVZK\,FDQQHYHUuse or apply HYHQP\PRVWREMHFWLYHÀQGLQJV,OLYHWKHP,´SOD\ with” them, and they “play with” me… LK: :LWKRXWUXOHV" HJP: Without rules, but with the help of my subconscious. Because every rule necessarily obeys rational ends, calFXODEOHREOLJDWLRQVLWDXWRPDWLFDOO\VHHNVXWLOLW\ZKHUH there should only be “sense.” How can that attract me? The only alternative to “play” is “sense”… And the “sense of sense” —maybe just another tier further up in what is IXQGDPHQWDOLQ%HLQJ³UHVLVWVDOOGHÀQLWLRQ« LK: What differences and similarities have you noted EHWZHHQ\RXU(XURSHDQDQG3HUXYLDQVWXGHQWV" HJP: ,QUHVSRQVHWRVXFKDVLPSOH\HWFRPSOH[TXHVWLRQ ,FRXOGSUDFWLFDOO\ZULWHDERRN%XWWKHUHVXOWZRXOGQ·W have anything to do with my profession or my activities. ,PXVWWKHUHIRUHFRQFHQWUDWHDELWRQP\DQVZHUDPRQJ German, Dutch, and Peruvian students, insofar as their absolute creative capacities, there is no difference whatVRHYHU DWOHDVWXSWRWKLVSRLQW,KDYHQ·WGLVFRYHUHG any on this “horizontal” level). Neither are there any substantial differences in the essence of the colors or VKDGHVRQO\WKHLUVSHFLÀF´DSSHDUDQFHµLVFKDQJHDEOHDQG not their “form,” the ways in which they observe things or WKHLUHIIHFWV«$OWKRXJK³DQGKHUH,·PLQHYLWDEO\DGGUHVVLQJ the material and ethical prerequisites as a basis for all possible realization of these universal sensibilities and H[SUHVVLYHIRUFHVZLWKRXWIURQWLHUV³WKHUHDUHVLJQLÀFDQW differences among the social systems (but this has been NQRZQIRUVRPHWLPHQRZ 7KHHFRQRPLFDQGWKXVVSLULWXDO and moral distances (not so much ethnic), or the unilateral FXOWXUDOLQÁXHQFHVWKDWKDYHVHSDUDWHGXVIRUDQXQEHDUDEO\ ORQJKLVWRULFDOWLPHDQGZKLFKZLOOFRQWLQXHWRDUWLÀFLDOO\ separate us, have created a differentiated “mentality,” the interpretation of which would be more interesting and necessary for a sociologist, historian, or psychologist than for me. But the thesis of a basic racial otherness is an LQYHQWLRQDSUHWH[WDSUHMXGLFH:K\DUHWKLQJVWKLVZD\, ZRQGHU"$QGRQFHDJDLQDKLVWRULFFRQWUDGLFWLRQ/RRNLQJ DWWKLQJVWKLVZD\,FRXOGVHQVHPXFKPRUHFRQFUHWHO\ 134 DQGSUREOHPDWLFDOO\DVIDUDV,P\VHOIDPFRQFHUQHGWKH so-called “differences” and “similarities” among the Dutch, Germans, French, Polish, etc. LK: ,VWKHUHODWLRQVKLSEHWZHHQDUWLVWLFH[SUHVVLRQDQG (sociocultural) life experience clearer, more direct and QRWLFHDEOHLQ3HUXYLDQVRUOHVVVR" HJP: ,VXVSHFWWKDW\RXUTXHVWLRQUHIHUVWRWKHDHVWKHWLF content, meaning the visual information of a politico-social nature; that is, the realities of this country or the biographical information of each person… This is one of the ´PRUDOµGHÀFLWVWKDWDUHEHJLQQLQJWRSOD\DQRWLQFRQVLGHUDEOHUROHLQP\ZRUNKHUHLQ/LPDDQGZKLFKDWWKHVDPH WLPHKDYHGHHSO\PDUNHGPHDVDKXPDQEHLQJVRPHtimes irritating me a great deal, or even disconcerting me: the confrontation with the acts that may be captured by the senses of this society —its “vertical” condition, so to VSHDN³LVRYHUORRNHGRUFRQVFLRXVO\LPSHGHGLQDUHJUHWWDble, almost enigmatic sort of way. What must arise from this is clear: adapted aestheticism, undemanding illustration, in the best case scenario a bit of routine technique… However, art doesn’t come from “power,” but from “duty,” and where the social praxis is not unconditionally oriented toward the bases of daily life, there can be no authentic DUWRQO\PHGLRFUHRUPRQXPHQWDOZRUNVRIWKHPRPHQW functional, and —what’s even worse— privileged ignorance… But does the decoration of acts have to do with creativity, or even more so, with freedom? LK: ,VWKDWDOVRDFULWLFLVPRIORFDOWHDFKLQJPHWKRGVLH WKHTXDOLW\WKHUHRI" HJP: Of course. For me, good teaching is always about DVNLQJDQGUHFHLYLQJTXHVWLRQV, not answers, and never a constant repetition of obsolete formulas, ex-cathedra… The quality of the question ultimately determines the quality of the answer; and vice versa, all intellectual activity — also including creative activity— becomes a paradox, a IDUFH«:KDWLVGHÀQLWHLVWKDWWKHUHFDQEHQRDHVWKHWLF without a direct social postulate, no “splendid isolation,” especially in a developing country. This is an eminently moral problem, isn’t it? Nothing comes from “below,” there LVDODFNRIFRQVFLRXVQHVVRISHUVRQDOH[LVWHQFH³LQRWKHU words, the consciousness of past and future. To put it more aggressively, in a climate of traditional repression and marginalization, there can only be libertarian tenden cies, “licentiousness,” and never liberty as a dimension or absolute ideal. And the illusion of liberty is nothing but the control of immaturity using absurd, “scholastic” methods… Everything is rationalized, revised, valorized, DOPRVWDVVRRQDVLWFRPHVLQWRWKHZRUOG«%XW,ZDQW to be able to accept everything that lives,IHHODJUHDW WHQGHUQHVVWRZDUGDOOOLYLQJWKLQJV,ZDQWWRLQLWLDWHVRPHthing, and accompany the movement, nothing more. That LVWKHUHVXOW,KRSHIRU LK: 'RHVDPDQDV´H[SHULPHQWDOµDV\RXUVHOIJLYHSUH IHUHQFHWRDQ\SDUWLFXODUDUWLVWLFWHQGHQF\" HJP: Yes, my life is experimental, relative. Everything can change from one day to the next; it must change constantly. 7KHUHDUHQRGHPRQVWUDEOHFRQVWDQWV0\ZRUNLVQRWKLQJ but the living expression of that. The name that can be given to all that, the pseudonym, is a problem for other people; it doesn’t interest me… From this springs forth a QHZDQWDJRQLVP,JLYHSUHIHUHQFHWRnone or all of the ´RIÀFLDOµGHFODUHGDUWLVWLFPRYHPHQWVSURYLGHGWKH\KDYH arisen from a vital need; that is, they are totally authentic. ,UHMHFWDOOWKDWLVIRVVLOL]HGGHDGQRORQJHUJURZLQJ DFDGHPLFDOO\FRQVHUYHGDQGGRJPDWLF,DPKRUULÀHGE\ DOODUWLÀFLDOUHVSLUDWLRQRIFDGDYHUVQRPDWWHUKRZH[RWLF they may be. 135 Joseph B. Adolph, “¿Qué pasa en Chosica?,” in Lima Kurier. El mensajero de Lima, Lima, n. 40 (December, 1983), pp. 1-3. SUHUHTXLVLWHVDQGDV,VHHLWDOVRWKHZLOOLQJQHVVWRFRQ tinue on, to learn, although falteringly. That’s something positive. WHAT’S HAPPENING IN CHOSICA? LK: 8QGHUVXFKIDYRUDEOHFRQGLWLRQVZRXOG\RXLQWHUUXSW \RXUZRUNLQ(XURSHIRUDWLPHLQRUGHUFRPHEDFNDQG WHDFKLQ/DWLQ$PHULFDRUVSHFLÀFDOO\DWWKH&DWyOLFDLQ /LPD" HPJ: ,·OOUHVSRQGWRWKDWZLWKDW\SLFDO/DWLQRSKUDVH Why not? LK::LOO\RXEHVRUU\WRLQWHUUXSW\RXUZRUNKHUHZKHQ \RXUHWXUQWR(XURSH" HJP: ,KDYHWRRPXFKWRGRIRUPHWREHVRUU\IRUZKDW ,GRQ·WGR LK: :K\GRQ·W\RXWHOOPHVRPHPRUHDERXWZKDW\RX·YH VHHQUHJDUGLQJWKHWHDFKLQJRIDUWKHUHLQ3HUX" H.J. PSOTTA HJP: :HOODWWKH&DWyOLFD,·YHPHWDKDQGIXORIJLIWHG\RXQJ men and women with an extraordinary creative potential, which fascinates me, even disturbs me. But this should be understood as an opportunity, as a mission; no attempt should be made to channel it. Methodologically, one should not be guided by “talent” but stop fearing the creative originality of the few, who are the only ones that justify the existence of an institute of learning. And this is the same all over the world… Thus, it is impossible to improve something without changing LWÀUVW LK: +DYH\RXEHHQWRWKH$FDGHP\RI)LQH$UWVLQ/LPD" HJP: Yes, the setting was an unforgettable impression HVSHFLDOO\DWQLJKW RQHRI&RFWHDX·VVXUUHDOLVWÀOPVFRXOG hardly be more fantastic… LK:<RXUVWXGHQWVDWWKH&DWyOLFDRIWHQFRPHIURPWKH PLGGOHRUXSSHUFODVVHV&RXOGWKHLUH[SHULHQFHVEH WUDQVIHUUHGWRRWKHUVHFWRUVDQGKRZ" HJP: Theoretically, yes. But what good does that do —as Brecht would say— if the conditions are not in place? )RUWKDWUHDVRQ,GRQ·WZDQWWRLGHDOL]HWKLQJVHLWKHU LK: :KDWZRXOGEHWKHRSWLPXPVLWXDWLRQLQRUGHUIRU\RX WRZRUNDWWKH8QLYHUVLW\H[DFWO\DV\RXKDYHSURSRVHG" HJP: Fewer students, who can peacefully investigate, in a concentrated and continuous manner, a number of aesthetic phenomena (that is, the grammar of our visual language, step-by-step, without “dramatic” ambitions): FKURPDWLFNLQHWLFVHPDQWLFLQWHUDFWLRQEDVLFGHVLJQDOO put into practice, context —just to name a few. Audiovisual combinations in all imaginable variations, and —above all— authentic themes. What really exists here are the Helmuth Julius Psotta was born in Bottrop, Westphalia, West Germany. His ancestors were Polish immiJUDQWVZKRZRUNHGLQWKH5XKU mining basin. Ever since he was a child, he had repeated contact with art in all of its most varied forms. +HEHJDQGHYHORSLQJDVFLHQWLÀFDOO\ grounded teaching and research method oriented towards problems of aesthetic philosophy. He has taught at various European institutions, as well as the Universidad Católica in Santiago, Chile (applied design at the School of Architecture). He was invited by Adolfo Winternitz to teach as a visiting professor at the Universidad Católica in Lima, a position he has held since March 1982. His focus is multidisciplinary, and his view of the world is rooted in the Renaissance: Psotta goes beyond the audiovisual; sensibility (sensuality) is an aspect that is just DVLPSRUWDQWDVVFLHQWLÀFDQGHYHQ technological rationality in his body RIDUWDQGKLVZRUN³QRQFRQIRUPLVW revolutionary— as a teacher. He lives DQGZRUNVLQKLVDWHOLHUVLQ+ROODQG and Germany, where he not only paints, but also writes essays, organizes experimental theater events, designs courses, plans trips, recites Neruda, and creates multimedia projects based on “artistic-social integration.” 7KHLGHDRIDWRWDORUWRWDOL]LQJDUWLVWLFH[SUHVVLRQPXVW EHDVROGDVWKHFDYHVRI$OWDPLUDDQGDVQHZDVFRPSXWHU VFLHQFH:KHWKHURUQRWWKH\PDQDJHWRH[KLELWWKHLUDUWLV WLFH[SHULHQFHVLQ/LPD WKH\·UHFXUUHQWO\ZRUNLQJRQWKDW  WKHWKUHHDUWLVWVYLVLWHGE\/,0$.85,(5LQPLG1RYHPEHU are attempting to make a multidisciplinary display of the JHVWDWLRQRIDZRUNDQGLWVDXWKRULQWHUZHDYLQJERWKOLYHV WKDWRIWKHFUHDWRUDQGWKDWRIWKHFUHDWLRQ 8QOLNH2VFDU :LOGH³ZKRVDLGKHSXWRQO\WDOHQWLQWRKLVZRUNZKLOH SXWWLQJDOORIKLVJHQLXVLQWRKLVOLIH³RXULQWHUYLHZHHV reject such loathsome discrimination, although this inter YLHZHUVXVSHFWVWKDWXOWLPDWHO\WKHSXEOLFZLOOEHLQWHUHVWHG —damn conservatives that they are!— more in the results, DQGOHVVLQWKHQRWVRRULJLQDOELRJUDSKLHVWUDXPDVDQG GUHDPVDQGQLJKWPDUHVRIWKHDXWKRUV7KHGUDZLQJVDUH YHU\JRRGLQWKLVLQWHUYLHZHU·VRSLQLRQDQGWKHDQHFGRWHV DUHDQHFGRWHV1DUFLVVLVPLQWKHEHVWRIFDVHVVHUYHVDV DIULHQGO\LOOXVWUDWLRQ )RUVHYHUDOGD\V,FRQVWDQWO\EUHDWKHGLQWKHRGRURIGHDG ÁRZHUV$XEUH\%HDUGVOH\·VSHUIXPHDQGGXVW,IPDQ·V PRVWVHULRXVDFWLYLW\LVSOD\DVVRPHWKLQNWKHQWKHJDPH of self-exploration —submerging oneself in death in order to hold on tighter to life, fusing those antagonistic lovers Eros and Thanatos— is the most serious of games. The ultimate game. /29(&5$)7$1'0$&+,1(*816 A year ago, Helmuth J. Psotta VHH/,0$.85,(5-XO\ 1982), Sergio Zevallos (21), and Raúl Avellaneda  WRRN UHIXJHZLWKWKHVXSSRUWRIWKH*RHWKH,QVWLWXWHLQWKHODVW house on the last street in a ravine in California, Chosica, where they could bellow softly at the world and establish themselves via an interior search conducted by means of artistic exploration.1 Perhaps it is a symptomatic symbol WKDWVHYHUDOZHHNVDJRQRZDPLOLWDU\IDFLOLW\ZDVHVWD blished a few meters higher up the mountainside, where soldiers engage in target practice and occasionally invade WKHOLYLQJJDUGHQWKDWVXUURXQGVWKHGHDGÁRZHUVLQVHDUFK RI*RGNQRZVZKDWVLJQVRIWHUURULVP3URXVWZRXOGGHV cribe this situation best, or in certain moments, Wilde. A bon mot can’t do much against a machine gun, and SHUKDSVGHVWLQ\RUVRPHRWKHUXQLGHQWLÀDEOHFRVPLFIRUFH KDVSHUPLWWHGLWVHOIDQDEVXUGMRNH Perhaps a group of soldiers is the current incarnation of UHDOLW\6KRUWO\DIWHUWKHJRRGRIÀFHVRIDQXQGHUVWDQGLQJ general, calm was restored. The house is beautiful, white, surrounded by wild gardens. The windows have been covered over, and only a few dogs 136 137 —and the occasional visitor— are allowed to cross through a doorway symbolically closed off by a melancholy rope. ,QVLGHWKHDLULVKHDY\PXVW\ZLWKDFRQVLVWHQF\WKDW seems to belong more to one of Lovecraft’s underworlds than the downcast luminosity of Chosica. The artists seem GHOLJKWHGE\WKHFKDQFHWRWDONDERXWZKDWWKH\GRWR H[KLELWLWDQGH[KLELWWKHPVHOYHV7KHZDOOVDQGWKHÁRRU ³WKH\GUDZSDLQWDQGVFXOSWRQWKHÁRRUVXUURXQGLQJWKH object and rotating it— are replete with repetitive exercises, ZLWKHDFKVWHSDGGLQJVRPHWKLQJPRUHRUWDNLQJVRPHWKLQJ DZD\IURPWKHZRUNVRIZKLFKWKH\DUH RUWKLQNWKH\DUH  the authors. 6$7$1$1'.,76&+ Overlapping drawings, prayer cards, posters describing how to breed rabbits or naming the parts of a pig, original images of saints, almost anything is mixed together with DXWRELRJUDSKLFDOWHVWLPRQLHV RQHRIWKHDUWLVWVDWKLVÀUVW communion wearing his uniform from Pestalozzi Private School): all of this, they say, is an expression of the different forms of violence from which the warp and woof of personal DQGVRFLDOH[LVWHQFHDUHZRYHQ,WLVSUHFLVHO\YLROHQFHWKDW is enemy number one, an enemy they are trying to exorcise —and not only violence expressed through direct physical aggression. The drama of the artists from Chosica, however, is as old as all exorcisms: maybe they realize it, or maybe not, but the exorcist ends up contaminated, and the face of Satan appears in his mirror. They themselves are also full RIYLROHQFHNQRWVKDQJLQJVPDVRFKLVPVDGLVPWKDW penetrate the world with the false gentleness of a roseFRORUHGGHPDJRJ\7KHLQLWLDOSDOHUHEHOOLRQWDNHVRQD certain rage; isolated, it may reach the point of self-complaFHQF\,WWKXVQHHGVFRQIURQWDWLRQDFWLYHVXEYHUVLRQLW needs the world to chew up those exquisite corpses and VSLWWKHPRXWRUVZDOORZWKHP-XVWOLNHUHYROXWLRQDULHV WHQGWRDFTXLUHDVVLPLODWHWDNHRQWKHGHIHFWVRIWKHYHU\ thing they question, the artist disintegrates only to reinteJUDWHDQGWKDWSURFHVVDVDQ\FUHDWRUNQRZVKDVLWVULVNV the recent vogue (especially in literature, but also in other arts) of integrating the frivolous, the language of the mass PHGLDNLWVFKVRPHWLPHVPHUJHVWKHVLVDQGDQWLWKHVLV with the treacle of concession. Protest, then, is turned into interior decoration. This is not (yet) the case with Psotta, Zevallos, DQG$YHOODQHGDZKRUHTXLUHKRZHYHUWKHVKRFNRIFRQfrontation, the rage of sacrilege (not only religious, but DOVRVH[XDO WRULGWKHPVHOYHVRIWKHLUREVHVVLRQV,WLVIURP this material that a large part of art is made: Michelangelo caused quite a stir when he clipped the wings off the DQJHOV3VRWWDDSURGXFWRIKLVWLPHWDNHVWKLQJVRQHVWHS further: in some two thousand drawings presenting variations on Buonarroti (“in homage,” he says, “to Baal-Belial DQGWKHODG\IURPP\QHLJKERUKRRGZKRJDYHPHP\ÀUVW FRORUHGSHQFLOVZKHQ,ZDVÀYH\HDUVROGµ KHFRQYHUWV the Pietas into slithering shiny and oleaginous labyrinths that simulate phallic serpents surrounding illuminated fetuses, jets of light and muscles that violently protest violence: Psotta reproduces the pain of the questioned Michelangelo, the humiliation, the sensation of being crushed, and reclaims them. (OL(OLODPDVDEDFWDQL« But also Ecce Homo 1983. 5(35(66,21$1'(;&(66 ,QDQH[FHOOHQWFRPPHQWDU\SXEOLVKHGLQ´(O&DEDOOR5RMRµ on August 28, 1983, Sebastián Gris [the art critic Gustavo %XQWLQ[@DQDO\]HVWKHWULR·VZRUNDQGPHQWLRQVWKH´H[SORsive ambiguity of Lima”: an unequaled description of the tissue of unresolved repressions that weigh on our society.2 For her part, Marielouise Alemann, an Argentine critic who belongs to the small group of persons (critics, artists, psychoanalysts) who have had access to the house in California, wrote of a “subversive, excessive oeuvre.”3 Between these two visions —that of explosive environmental ambiguity and that of an outsized rebellion— there ocFXUVDGLDOHFWLFRIVKRFN$QGLWVXUHLVDVKRFNIURP6DLQW 5RVHRI/LPDXQYHLOHGIURPFKLOGOLNH´SXULW\µQDLOHGWRWKH ZDOOOLNHDEXOO·VH\HXVHGIRUWDUJHWSUDFWLFHIURPVDFUHG local machismo, the spectator slides, uncontrollably, into a trembling of legs. Something is happening. Something has FHDVHGWRPRYHIRUZDUG,WZRXOGQ·WEHVXUSULVLQJLIWKH indignant howls of certain people ultimately turn out to EHWKHV\QWKHVLVRIWKRVHWKHVHVDQGDQWLWKHVHVVWLFNLO\ HPEUDFHGLQWKHNLQJGRPRIDPELJXLW\DOZD\VRQWKHYHUJH of exploding but never quite doing so, with what [Peruvian writer] Julio Ramón Ribeyro called, half-pejoratively and KDOIIXULRXVO\WKH´/LPDFKXFNOHµ)URPDFHUWDLQSRLQWRI view, the soldiers who came searching or pretending to VHDUFKIRUWHUURULVWVDPRQJWKLVOLWWOHJURXSRISDFLÀFDUWLVWV PD\QRWEHVRPLVWDNHQDOWKRXJKWKHUH·VQRWHYHQD SURSHUO\VKDUSHQHGNQLIHWREHIRXQGLQWKHKRXVH7KH VXEYHUVLRQRIDUW³DV6WDOLQDQG+LWOHUZHOONQHZ³PD\ KDYHGHYDVWDWLQJHIIHFWV/XFNLO\RUXQIRUWXQDWHO\LQ/LPD DOPRVWQRRQHWDNHVDUWRUDUWLVWVVHULRXVO\ZKLFKLVZRUVH LQVRPHZD\VWKDQWKHSV\FKLDWULFZDUGWKHÀULQJVTXDGRU exile. As the tradition goes, “in Lima, even microbes become stupider.” (;48,6,7(&2536(6 What these three artists have been producing in Chosica is, of course, a new version —“Mannerist,” says Psotta— of the ancient love/hate relationship between Eros and Thanatos. This is almost a platitude. But the most important thing is that they are managing to personalize it, give it a personal content and form, and that is probably their JUHDWHVWPHULW,VQRWDUWLQLWVPRVWYDOLGPRGHOVWKHSHUsonal interpretation of archetypes, of the profound currents RIWKHVXEFRQVFLRXVWKDWKXPDQLW\FROOHFWLYL]HV",IWKLVLV so, then what is happening in Chosica is a new chapter in the ancestral drama that has been carried out for millenQLDWKDWRIDQDQLPDOZKLFKGHÀQHVLWVHOIDV´VDSLHQVµ DQGGDUHVWRFRQIURQWWKHXQLYHUVHZLWKWKHPDJQLÀFHQW insolence of fallen angels, to respond to questions whose ultimate answer continues to elude us: How can we live, when there exists such a thing as death? How can we die, when there is such a thing as life? Where should we direct our gaze, when we are surrounded inside and outside our VNLQE\WKHLQGLIIHUHQFHEODFNQHVVRIWKHQHJDWLYHLQWHUUXSWHGRQO\E\WKHJORULRXVDQGWUDQVLWRU\VSDUNRIORYH" 7+(*5283$&&25',1*72,76(/) ,QWKHIDFHRIDUWWKHUHDUHWZRSRVVLEOHDWWLWXGHV LQDGGLtion, naturally, to that of non-recognition): that of enjoyment and that of analysis. Often, one excludes the other; on occasions, one murders the other. Enjoyment belongs WRWKHÀQDOLVWLFWHUULWRULHVRIDUWLWLVWKHPHHWLQJRIWZR sensualities. Analysis, sometimes transmuted into autopsy, is the scalpel of reason digging —and yes, cutting!— into the GHOLFDWHÁHVKRISRHWU\WRTXDQWLI\LWVFRQVWLWXHQWFKHPLFDO elements. The following is the group’s self-analysis: Project: Development, visualization, documentation, and presentation of direct aesthetic processes by means of multimedia WHFKQLTXHVRIUHSUHVHQWDWLRQDVDWKHPDWLFDOO\OLQNHGJURXS activity. Elaboration of an aesthetic phenomenology with non-empirical inductive-deductive methods. Goal: The underlying ideal and true goal of group activity should be: individual investigation, discovery, and description of identical or similar elemental motivations (biographic situations) or identical life circumstances (semiotic). Spontaneous noting down and elaboration of direct impulses (conscious/unconscious) and their revelation “in code”, or manifestation through aesthetic-semantic and PDWHULDOWHFKQLFDOPHDQVVXFKDVVHOIVXIÀFLHQWSURMHFWV Documentation: 6LPXOWDQHRXVO\WRWKLVVXEMHFWPXOWLPHGLDZRUNWKHJURXSV VHHNVWRFULWLFDOO\REMHFWLYL]HWKHIXQGDPHQWVDQGVWUXFWXUH RILWVÀQDOO\DFFHSWHGUHVXOWVLHWRFRRUGLQDWHWKHHPSLULcally recognized facts, as well as the motivations for their appearance as visual (auditory) and verbal (documentary) information, and analyze and interpret them deductively (for example, myths, symbols, historical-biographical connections, etc.): the continuity of the development SKDVHV ZRUNLQJSULQFLSOH WKH´JHQHVLVµRIWKHUHVXOWV must be made intellectually and experientially accessible (methods and phenomena of collective self-representation). Presentation: The elements of documentation are a base and part of the presentation of the total project elaborated (visualized) (integration). NOTES &RQFHSWRI:RUN ,QTXLU\²GLVFRYHU\²WUDQVFULSWLRQ²YLVXDOL]DWLRQRID non-empirical personal/collective myth. 1 See Joseph B. Adolph, “H. J. Psotta: Todo y/o nada,” in Lima Kurier, Lima, n. 25 (July 1982), pp. 120-122. See English translation in pages 133135. (Editor’s note). ,GHD&RQWHQW The group attempts to translate their individual experiences of a biographical and/or social (political) nature within WKHIUDPHZRUNRIDVKDUHGDHVWKHWLFPDWHULDODQG emotional-intellectual context into a broad personal lanJXDJHRILPDJHV7RGRVRWKH\VHHNWRPDNHRSWLPXP use of all current conventional and experimental means of expression and materials (available), especially their freely combinable possibilities (drawing, assemblage, mise-en-scène, acting, photographic series, sculptures, auditory media, etc.). 7KHSURJUDPPDWLFRUSUREOHPDWLFFRQÀJXUDWLYH conception of the content is completely open from the EHJLQQLQJ,WLVQRWSUHIRUPXODWHGRUREMHFWLYHO\GHÀQHG The creative process may thus be carried out with absolute psychological dynamics in an inductive form up until the moment of subsequent improvisational realization (quantitatively and qualitatively), and be concretely represented, regardless of external commissions and primary historical LQÁXHQFHV 2 See Sebastian Gris, “Una experiencia extrema en nuestro arte,” El Caballo Rojo, suplement of El Diario Marka, Lima, 28 March, 1983, pp. 10-11. (Editor’s note). 3 See Marilouisse Alemann, “Grenzgänger,” Argentinisches Tageblatt, Buenos Aires, 23 July, 1983. (Editor’s note). Miguel Silvestre, “A propósito de una muestra de ‘Chaclacayo’: Cuando el ser auténtico resulta ser peligroso,” in El Diario de Marka, Lima, 27 November, 1984, p. 18. WHEN ONE’S AUTHENTIC SELF TURNS OUT TO BE DANGEROUS APROPOS OF AN EXHIBITION BY “CHACLACAYO” DQGHPRWLRQVWKDWPLJKWEHVKRFNLQJEXWOLNH,VDLGEHIRUH WKDWDVSHFWIDOOVRXWVLGHRIP\ZRUN 6RLWZRXOGEHLOORJLFDOWRWU\DQGSLJHRQKROH\RXUZRUN" 7DNLQJULVNVLVWUXO\GDQJHURXVVHHNLQJDXWKHQWLFLW\HYHQ more so. The Grupo Chaclacayo depicts its own experience and, at the same time, a story that could belong to any RQHRIXVLQWKLVIRUVDNHQFRXQWU\ A world of images that belong to us, some of which we RXUVHOYHVDUHJXLOW\RI$GHP\VWLI\LQJIRUFHIXOZRUNOLNH a slap in the face of public opinion. What follows is only a fragment of a conversation that may never exhaust itself, as well as the testimony of a sensibility that refuses to die. The artists: Helmut J. Psotta (Germany), and the Peruvians Raúl Avellanada and Sergio Zevallos. &RXOG\RXWHOOXVDERXWKRZWKLVZRUNJRWVWDUWHG" HJP:,FDPHWR3HUXWZR\HDUVDJRLQYLWHGE\WKH8QLYHUVLdad Católica to teach a course in my area of specialization, but my intention was not actually to teach but rather to JHWWRNQRZWKLVFRXQWU\IURPWKHLQVLGH:KDWKDSSHQHG at the university is anecdotal; just for conducting my class in the form most consistent with reality —that is, a reality ZKHUHPLVHU\DQGGHDWKDUHHYHU\GD\RFFXUUHQFHV³,ZDV UHMHFWHGE\DOORIP\FROOHDJXHV%XWWKDWDV,VDLGLVMXVW DIRRWQRWH:KDW,KDYHUHDOO\EHHQORRNLQJIRURYHUWKHVH ODVWWZR\HDUVDUHPRUHLQWHQVHVHQVDWLRQV,FDQ·WÀWLQ with large herds of people, and my two colleagues are a consequence of that fact. /HW·VWDONDOLWWOHELWPRUHDERXWZKDWHDFKRI\RXLV VHDUFKLQJIRU HJP:)RUH[DPSOHLQWKHSKRWRVLQWKHH[KLELWLRQ,·PWU\LQJ to express another aesthetic. They simply depict the way ,DP<RXFDQVHHWKDWLQWKHSKRWRJUDSKVDVDZKROHD symbology, which has its raison d’être in everything from WKHFRORUZKLFKLVEODFNWKHYLVLRQRIGHDWKUHSUHVHQWHG in the pointed caps, which are, in turn, the Tribunal of the ,QTXLVLWLRQWKH.X.OX[.ODQWKHPLVVLOHVSRLQWHGDWXV to the rituals of death and the struggle for power. SZ:,WLVGHÀQLWHO\DWHVWLPRQ\RIZKDW,·YHOLYHGWKURXJK ,W·VVRPHWKLQJWKDWULVHVVORZO\LQWR\RXUFRQVFLRXVQHVV DQGH[SUHVVHVLWVHOIWKURXJKWKHZRUN7KH\·UHDVHULHVRI experiences, and there’s no premeditated intention behind WKHPLW·VMXVWOLNHGHSLFWLQJ\RXURZQLPDJHLQDPLUURU 5$,QP\FDVH,WKLQNSDUWRIP\ZRUNLVDQDXWRELRJUD SKLFDOLQYHVWLJDWLRQ,MXVWGRWKLQJVDQGWKHZRUNRILQWHUpreting it is left up to the psychologists, the anthropologists, etc. ,QWKHFDVHRIWKHER[HVWKH\·UHDZD\IRUP\FXUUHQWVHOI WRORRNEDFNDWP\SDVWVHOIZLWKWKHZHLJKWRIH[SHULHQFH HJP:2IFRXUVH,QWKHFDVHRIWKHSKRWRVHYHU\WKLQJLV FRQFHSWXDO,W·VDZD\RIVHHLQJDYHU\FRQFUHWHUHDOLW\ 2QHVHHNVWRLPSRVHRUGHUDPRQJVWWKHFRQIXVLRQ,QP\ GUDZLQJV,UHIHUEDFNWRVRPHWKLQJFRPSOHWHO\(XURSHDQ Michelangelo, who for me was a revolutionary in disguise. %DVHGRQWKDWPRGHO,HVWDEOLVKDSHUVRQDOZRUOG7KHUH you can see pigs and roosters, and these things have in fact had their importance in my life, as well as sexual acts. What is human is an entire universe. There are no parameters. Not even among the “art critics” who say that VH[XDODFWVVKRXOGEHGRQHLQSDUNVRUDQ\ZKHUHEXWWKH WHUUDLQRIZKLFKWKH\DUHDSSDUHQWO\WKHPDVWHUV,OLNHDQ DFWRUDPJRLQJWRXVHH[WUHPHIRUPVRIH[SUHVVLRQ,XVH WKHDEXVHVXIIHUHGE\ZRPHQDVDIRUPRIGHP\VWLÀFDWLRQ RA:,W·VDQDQWLUHSUHVVLYHZRUNDJDLQVWZKDWZHUHIHUWR as malign myths, which are expressed in our society in the IRUPRIDQHIIHPLQDWH&KULVW,FDQ·WKHOSEXWZRQGHUZK\ Jesus is never shown with breasts. SZ: There’s a parallel there. While Saint Rose selfÁDJHOODWHVDQGLQÁLFWVSDLQXSRQKHUVHOILQRUGHUWRJDLQ mystique, in this country bodies are tortured and dumped in mass graves, and there will be no pardon for those people. $QGZK\GLG\RXRSWIRUDJDOOHU\WKDWLVWKHVFKHPDWLF UHSUHVHQWDWLRQRIWKDWDFDGHPLFLVP\RXÀQGVRUHSUHVVLYH" HJP: :HKDYHWRDGDSWWRWKHFLUFXPVWDQFHV,QDQ\FDVH ZH·UHQRWVHHNLQJFKHDSSXEOLFLW\ SZ:7KHZRUNVLQWKHPXVHXPDUHDELWFORVHGRII,QWKH studio, it’s different, because it presents a rupture with that enclosed scheme. But apart from that, it could be said that the exhibition, even if it’s only a small sample, HVWDEOLVKHVVRPHWKLQJWKDWZHDFWXDOO\QHYHUORRNHGIRU on purpose: contradiction. HJP: We’re appealing to a certain sensibility. We’re not VHHNLQJSUHSODQQHGJHVWXUHVDQGZHGRQ·WQHHGDQDUW fair. SZ: 7KLVÀUVWVWHSLQWKHPXVHXPLVDOPRVWSHGDJRJLFDO but these sorts of circumstances usually don’t even occur here. )RXURIWKHZRUNVKDYHEHHQH[SUHVVO\SURKLELWHGE\WKH (PEDVV\RIWKH)HGHUDO5HSXEOLFRI*HUPDQ\« 139 Hugo Salazar del Alcázar, “Chuang-Tse, Freud y el sueño peruano,” unpublished manuscript, Lima, ca. 1984-1985. Sergio Zevallos archive. HJP:7KH*RHWKH,QVWLWXWHRQO\SURYLGHGIXQGLQJIRUWKH exhibition, but there was no grant. The two years we’ve spent in Chaclacayo were paid for with my own sources of income. We don’t owe anyone anything. They can’t prohibit WKLVZRUNEHFDXVHWRGRVRZRXOGEHIDVFLVW7KHIDFW WKDWQR3HUXYLDQLQVWLWXWLRQVKDYHFHQVRUHGRXUZRUNLV symptomatic. CHUANG-TSE, FREUD, AND THE PERUVIAN DREAM RA: The ban is arbitrary and was made by unprofessional people. Half an hour before the inauguration of the show, WKHUHZDVQRSURKLELWLRQ,WKLQNWKHVHLQVWLWXWLRQVDUH never going to get behind an authentic and honest attitude DLPHGDWUDLVLQJFRQVFLRXVQHVV,WVHHPVOLNHWKHRQO\ thing the institution promotes is propaganda and obedient, tame things. 7KH\·YHJLYHQ\RXDQXOWLPDWXP« Effectively, what the embassy did was to cover up the ZRUNV7KHSXEOLFOLIWHGWKHEDQLQDQDWXUDOZD\1RZ they’ll probably want to shut down the exhibition, and that’s something we won’t allow. Apparently, this has offended some people, but on the other hand they don’t seem to be bothered by people dying every day, by the massacres, the missiles pointed around the world, or mass hunger. Maybe they’re just trying to NHHSWKHLUJDOOHULHVLPPDFXODWH 1 &KXDQJ7VHRQFHUHODWHGWKHIDEOHRIWKHÁRZHUWKDW GUHDPHGLWZDVDEXWWHUÁ\DQGZKHQLWZRNHXSLWGLGQ·W NQRZLILWZDVDEXWWHUÁ\GUHDPHGXSE\WKHÁRZHURUD ÁRZHUWKDWGUHDPHGLWZDVDEXWWHUÁ\,QDZD\WKLVIDEOH DOOXGHVWRZKDW)UHXGLQKLVERRN´7KH,QWHUSUHWDWLRQ of Dreams,” would come to call dream substitution and displacement. 7KHWHUULWRU\RIWKHZRUNVDQGYLVXDORIIHULQJVRQ KDQGLQWKHH[KLELW´3HU~«$'UHDPµEULQJVXVEDFNWR Chuang-Tse and his fable. Condensation, substitution, and displacement of that which we have dreamed (conceptualized) in the form of objects, images, settings, and events that materialize into a proposal which the spectator must strive to reassemble at random, as a whole. There, as LQWKHIDEOHRIWKHÁRZHUWKHLPDJHVHYRNHGWKURXJKLQWXL WLRQVDQGUHYHODWLRQVOLNHDJDPHRIPLUURUVRU&KLQHVH ER[HVEHJLQWRLQWHUPLQJOHDQGVWDNHRXWWKHLURZQYLUWXDO materiality. 2 7KXV´3HUX«$'UHDPµLVDUWLFXODWHGOLNHDGUHDPPHFKDnism: images free from censorship and repression, as well as from logic at a conscious and materialized level, sometimes with a poetic-visual effusion, others in the form of a SDWKHWLFGHPRQRORJ\RUPRUELGQLJKWPDUHWKDWRQHVHHNV to deny but which nevertheless exists, just as the struggle between angels and demons exists within, mutually striving WRH[SLDWHRQHDQRWKHU,QWKLVVWUXJJOHOLHVWKHVWUXJJOH between the impulse of life and destruction, the private DQGFROOHFWLYHJKRVWVOXUNLQJVRPHZKHUHLQRXUVXEFRQVFLRXV,PDJHVRIVH[HGXSVDLQWVPDJLFULWHVFULPHV IXQHUDOFKDSHOVDOOLQWHUPL[HGDWWKHVDPHWLPH,EHJLQWR HYRNH%DWDLOOH/DXWUpDPRQW3DVVROLQLWKHYDJLQDGHQWDWDV RIRXUSUH&ROXPELDQFXOWXUHVWKH,QTXLVLWLRQWKHIXQHUDO ULWHVRIWKH$QGHDQZRUOGDQGÀQDOO\GLUHFWRUFLUFXPVWDQtial physical violence, private and national, that we have EHHQIRUFHGWROLYHWKURXJKLQUHFHQW\HDUV,VWKLVWKHQDtional dream? 3 7KHVHLPDJHVOLNHLPDJHVIURPGUHDPVDUHRYHUVL]HG mutilated, sexualized, and recontextualized. There is a FRQVWDQWRIVHOIPXWLODWLRQDQGWUDQVYHVWLWLVPLQWKHÀJXUDO images of the actors in this intense experiment, something that may be initially intuited as a narcissistic effusion but which gradually transforms into a subject of analysis, ideoORJLFDOHYHQWRUVRFLRDQWKURSRORJLFDOUHÁHFWLRQ7RDFKLHYH this, the artists resort to the reiterated use, or rather the deliberate abuse, of the most profound and intrinsic components of our collective and individual myths: sex, religion, 140 Sergio Zevallos, “La muerte obscena / Perú: 1982-1988. Una obscura matriz para mis imágenes”, unpublished manuscript. Published in German as “Der Obszöne Tod. Peru: 1982-1988. Eine finstere Gebärmutter für meine bilder,” in: Grupo Chaclacayo, Todesbilder: Peru oder Das Ende des europäischen Traums (Berlin, Alexander Verlag, 1989), pp. 61-63. 141 and death. Thus, the transgressions, mutilations, transvestitism, and inscriptions journey outside the physical ERG\LQRUGHUWRDUULYHDWDGLIIHUHQWÀQDOREMHFWLYHWKH body and ideology of the Peruvian people. And it is preciseO\WKHVHLPDJHVWKURXJKWKHDUWLÀFHRIWKHLUV\PEROVDQG metaphors, which reveal to us the inorganic, mutilated body of the Peruvian people. THE OBSCENE DEATH / PERU: 1982-1988 A Shadowy Womb for My Images EHWZHHQ&DWKROLFSDWKRVLQLWVPRVWÁHVKHGRXWFRORQLDO expression, the myth of Saint Rose of Lima, and the idolatry of men by men in the worship of national heroes; WKH,QTXLVLWLRQ&RXUWDQGLWVPRGHUQGD\HTXLYDOHQWWKH institution of torture during police interrogations; the urban deformations of ancient Andean funerals and clandestine PDVVJUDYHVRUWKHWUDIÀFNLQJRIYLFWLPVRISROLWLFDOSRZHU Blood – incense – ash are media and metaphor here for WKDWVLFNO\GRZQKLOOVOLGHIURPOXVWWRGHDWKWKDWDGYDQFHV surreptitiously from one case to the next, an insurmountDEOHDWDYLVPZKRVHRULJLQVGDWHEDFNWRWKHHYDQJHOL]LQJ crusade of the sixteenth century. A living example of this can be seen in the “ProcesVLRQRIWKH/RUGRI0LUDFOHVµZKLFKSDFNVWKHVWUHHWVRI Lima to bursting each October with its amorphous and violet-colored multitude. Lethargic, sweaty, submerged in clouds of incense, they bear the weight of an impassive and sterile Christ in the name of their outsized pseudoUHOLJLRXVORQJLQJV2QHIHHOVDVLIKHKDVJRQHEDFNLQWLPH watching this ignorant mass go by in a Funeral March as a group of bored bishops bless them mechanically, the tremendous submission of a people who have long ago forgotten their true identity. At the other extreme of indigeQRXVP\WKZHÀQGPRUHHORTXHQWV\PEROVIRUWKH&KULVWLDQ XVXUSDWLRQRIWKHLUDXWKHQWLFFRQWHQWV,QFHUWDLQSDUWVRI WKH$QGHVWKHODQGLGHQWLÀHGZLWKWKH9LUJLQ0DU\LVDOVR associated with amphibians; her invocation as a female deity under the name of Saint Mary the TOAD is carried out while torturing these animals, whose cries are meant to “seduce” the Water God to wash over Her. Here we have WKH0\VWHU\RIWKH,PPDFXODWH&RQFHSWLRQUHYHUWHGWR its profane and biological condition, in this metaphorical combination of Toad-Mater Dolorosa, an attempt to bear the tragic destiny of their “Mother Earth” bathed in blood by the European FRQTXLVWDGRUHV. Such symbioses of symbols fascinate me to no end, providing a captivating subject for depiction. 7KHUHDULVHVWKHQWKHTXHVWLRQ´+RZGR,RSSRVH this enormous accumulation of dementias?” Spontaneous PRFNHU\KDVDOZD\VEHHQP\DOO\DQGLQWKLVDWWLWXGH ,KDYHIRXQGDQDXWKHQWLFFUHDWLYHSULQFLSOHLQWKHtransgression of all dogmatic norms and ideologies, inverting their traditional meanings via free or premeditated associations. However, by establishing this new symbolic form, ,ÀQGP\VHOIRQWKHSDWKEDFNWRWKHJUDYHVHULRXVQHVVRI the facts, thus tipping all the weight of the “scale” —my biography— toward the human side. Turning my experience of violence into the ability to express it as sensitively and forcefully as possible: that is my ideal. 7KHDHVWKHWLF,GHYHORSDOVRKDVDVSHFLÀFLQÁXence: squalor, its aspect, and the scenes to which it gives ULVH,DPGHÀQHGE\DVHQVLELOLW\IRUPHGWKURXJKWKH permanent observation of trash heaps and human degradation, where the arrogant vanity of the dominant class parades around, marginalizing everything under a tasteless 4 As such, the visual, non-physical operations of the German Helmutt Psotta and the Peruvians Raúl Avellaneda and Sergio Zevallos, authors of “Peru… A Dream,” use the visual as a starting point to establish themselves in the ethical, a border wherein lifestyle and style of art begin to GLVVROYHDQGORVHWKHLUKDELWXDOERXQGDULHV,WLVKHUHWKDW it becomes useful to refer to Chuang-Tse’s fable about the boundary between dreams and what we have dreamed; and to the writings of Freud, when he was studying dreams, who noted that in order to experience the possibility of quenching his thirst, he ate his last meal of the day with an excess of salt, so that he could get the most possible SOHDVXUHRXWRIDJODVVRIZDWHUZKHQKHZRNHXSLQWKH PLGGOHRIDGUHDPWKDWKDGHYRNHGLQKLPDGHVSHUDWH thirst. 5 ,QDFHUWDLQZD\3VRWWD$YHOODQHGDDQG=HYDOORVKDYH attempted to increase the portions of salt (and chili pepper) in the Peruvian dream with their exhibition “Peru… A Dream,” showing this dream to us with all its cruelty and poetry, its truth and lies. But now, more than ever, we need that glass of water that Freud would set on his nightstand, RUDWWKHYHU\OHDVWZHQHHGWRZDNHXS« ,VKDOOUHIHUKHUHLQWRVRPHRIWKHPRWLYDWLRQVDQGOLIH circumstances whose contents forged the nature of those VHULHVRILPDJHVWKDW,FUHDWHGDVSDUWRIWKHSURMHFW 3(58«$'5($0, by Grupo Chaclacayo. 8SIURQW,PXVWQRWHWKDWWKHSK\VLFDO³DQGWKXV psychological— distance from the reality and common norms of Peruvians, while still permitting the critical observation thereof, was the only possibility for unconditionally developing my expressions. This creative profusion was also the result of crossing paths with Helmut Psotta, a meeting whose meaning lay in the intense confrontation between two consciences and sensibilities rooted in radically opposite realities of today’s Western world. Through this, we were able to achieve an ideal space for WKHWDVNRIGHP\VWLÀFDWLRQEDVHGRQLPSDUWLDOLW\DQG mutual respect. Later on, Christian culture as an inherent principle of all historical causes neutralized any apparent differences, spontaneously establishing a point of departure for our depictions. To be Peruvian in today’s world is to have grown up in a country rooted in the constant threat toward the LQGLYLGXDODVDQRIÀFLDOPHWKRGRIFRQWURODFFHSWHGE\DOO it is to defenselessly withstand a drastic moral decline and its aftereffects in the absence of any inhibitions against murder; to grow permanently accustomed to banal deaths FDXVHGE\VLPSOHDYRLGDEOHPLVWDNHVDQGGHOLEHUDWH ones, too. So many simultaneous aggressions wind up turning the very meaning of existence upside down. To live promiscuously with that Death which forces upon us the visual consumption of countless cadavers, cadavers that WDNHRQDOHDGLQJUROHLQDJURWHVTXH´+XPDQ7UDJHG\µ exposing their indecency before our even more indecent gazes, a lugubrious scene from a day-to-day life gone astray in this irrational history. ,IWKHIRUHJRLQJVRXQGVOLNHDQLJKWPDUHP\ZRUNV must assume that same obsessive nature which leads them without fail to the bowels of being. This emotional LPSHUDWLYHZDVDOUHDG\DWZRUNLQWKHÀUVWVHULHVRIDFWLRQV ,SHUIRUPHGLQ/LPD·VVXEXUEVXQGHUWKHWLWOH´3DVVLRQV of a Wandering Body” —the incarnation of a collective GHVWLQ\,QWKHYHU\ZRPEWKDWJDYHOLIHWRP\\RXWK,LQWHUpreted a morbid Danse Macabre surrounded by rubble, my nude body bound by bandages personifying impotence DQGVKDPHOHVVQHVVLQWKHIDFHRIDEDQGRQPHQWOLNHD sensitive statue on cold stone in the middle of a storm. Simultaneously to the creation of my drawings, ,FROOHFWHGDFRUSXVRIHYHU\GD\WH[WVDQGLPDJHVZLWK references to cults and myths, whether religious or proIDQHZLWKZKLFKWRRULHQWP\VHOIDFRQVWDQWDWWHPSWWROLQN past and present, using my own biography as a meeting point for all the given elements. There came the meeting OD\HURIPDNHXS,WLVLQWKLVPL[WXUHZKHUH,ÀQGWKDW which is truly obscene. But concealing spiritual or physical VTXDORUDQGWKLQNLQJRQO\RI´EHDXW\µDVGHÀQHGE\DQ DPELYDOHQWPRUDOVHQVHWKHHVVHQFHRINLWVFKDQG cynicism, are widespread traits in the West. This is the OBSCENE DEATH. Thus, the “libido” of the objects used, followed by the consciousness of the banal or brutal use WKDWJLYHULVHWRWKHPDQGÀQDOO\WKHPHDQLQJREWDLQHG from the dialectical combination of the two have been essential stimuli for elaborating a language in the form of a Symbol-Trace or Symbol-Wound, profane relics of my particular gaze. ,QWKLVFRQWH[WQXGLW\³WKHWUXH&RUSXV'HOLFWL³ LVDOZD\VDVLJQLÀHURIPXUGHUHYRNLQJWKHDQLPDOQDWXUH that comes before being human, the primordial violence from which we spring. Sexual elements are infected with the same meaning, with their more or less direct allusion introducing a vertiginous sentiment of prohibition, thus achieving the maximum possible tension in a synthesis RILQIRUPDWLRQ$QGRQFHDJDLQUHDOLW\MXVWLÀHVPHUDSH and sexual torture using the penis as an instrument of submission are acts from which our culture can never recover. And from this, one can infer the principal target RIP\PHVVDJH«PHQRUPRUHVSHFLÀFDOO\WKHW\SHRI women without a womb into which we have degenerated. $ORQJWKHVHVDPHOLQHV,ZRXOGOLNHPDNHQRWH of the phenomenal act that summarizes all the different YDULDQWVRIP\IRUHJRLQJUHÁHFWLRQVWKHODVFLYLRXVEXULDO of Saint Rose (Lima, 1617), where a people desperate to possess her as a relic profaned her defenseless body almost as soon as she had died: this poor daughter of Catholicism, violated to this very day by masculine devotion —which tries in this way to expiate its frustrated sexuality— converting her into a hybrid between a Virgin and ExeFXWLRQHUWREHYHQHUDWHG6KHLVDFRQVWDQWLQP\ZRUN covering all the degrees between eroticism and brutality, DQGKHUH,UHIHURIFRXUVHWRWKHP\WKWKH&KXUFKVR pompously spreads. All of these contents should be interrelated amongst themselves in a cyclical sequence, returning always to the elemental chaos from which they arose to once again achieve an explicit form, ever freer and more IRUFHIXOWRPDNHRILWDOODPLUURUDPhysiognomy of the +XPDQ&RQGLWLRQDEOHWRHYRNHWKHFRQFUHWHVHQVDWLRQRI ZKDW,ZLVKWRH[SUHVVWKDWLVFUXHOW\DQGWKHGLVJXVWLW produces in me. Claudia Peter, “Südamerikanische Kunst aus Leid, Wut und Ekel,” Stuttgarter Nachrichten, Stuttgart, 6 June, 1989. [Unknown author], “Todesbilder”, ZYMA Kunstmagazin, Stuttgart, n. 2/3 (May-August, 1989). 143 A SOUTH AMERICAN ART OF PAIN, RAGE, AND DISGUST Images of death by the “Grupo Chaclacayo” of Peru at the International Relations Institute TODESBILDER (Images of Death) Peru, or the End of the European Dream Grupo Chaclacayo by Psotta, Zevallos, and Avellaneda. They place before our eyes a death that is sinister, lurid, and terrifying, just as violence, terrorism, and torture are, too. Their tabooshattering photos, drawings, and box-objects are traumatic PDQLIHVWRVDJDLQVWYLROHQFHEUXWDOLW\DQGIHDU7KHVKRFN unleashed by these images frequently crosses the boundaries of psychological pain. They are provocative because of their obsession, their neurotic irrationality, their savage and expressive blasphemy. Their slanderous objective resistance is in fact the result of psychological and artistic confrontation with a society that lives its life accustomed to violent death. This art is a potential resistance against a grave reality, and it is profoundly moral.” Thus, the theme of this exhibition is violence and death. A group of Peruvian artists is attempting to prove the increasingly controversial claim that art can have a VRFLDOHIIHFWGHSHQGLQJRQKRZRQHORRNVDWLW7KHGHWHUmining condition here is that what is understood by art, its possibilities for action, as well as our habits of reception PD\KDYHWKHDELOLW\WRLQKDELWDQRWKHUNLQGRIFRQVFLRXVness for this type of artistic residue. Otherwise, the effort of these types of groups and individual artists will fail to resonate and will have no effect, either for them or for us. This would mean a lost opportunity to clamor for an art ÀWIRUWKHPDVVHV ,QWKH*HUPDQDUWLVW+HOPXW3VRWWDZLWKGUHZIURP his position as visiting professor at the Universidad Católica in Lima to dedicate himself to his art, together with his students Sergio Zevallos and Raúl Avellaneda, in a small oasis in the mountains of Chaclacayo, driven by a shared dream of peace and freedom. The resulting drawings, objects, sculptures, and performances do not depict utopian dreams, but traumatic, excess-ridden interpretations of violence, fear, and terror as a visible way of overcoming psychological and physical pain. There are two emotions that drive Sergio Zevallos to struggle artistically against the terror and murders being ZURXJKWLQ3HUXUDJHDQGGLVJXVW7KHDUWLVWVPDNHXVH of metaphors that have been widely repressed in everyday OLIHELUWKDQGGHDWKHURWLFLVPDQGVH[XDOLW\ÁRZLQJEORRG dead bodies wrapped in shrouds, sexual symbols engaged LQUDSH&KULVWLDQLFRQRJUDSK\EODVSKHPRXVO\GHP\VWLÀHG VKRFNDQGKRUURUVKRZQGLUHFWO\DQGEOXQWO\ One example is Raúl Avellaneda’s box-object: a large spider sitting on a blonde wig represents the vile thoughts of the white race, who have exploited mestizos, LQGLJHQRXVDQG,QGLDQSHRSOHVIRUFHQWXULHV7KHDUWLVWV VHHNDXWKHQWLFPHDQVRIH[SUHVVLRQ³(XURSHDQ 3VRWWD  DQG3HUXYLDQ =HYDOORV$YHOODQHGD ³WRPDNHVXUHERWK points of view are on display. 7KLVSURMHFWHQWLWOHG´,PDJHVRI'HDWK3HUXRU the End of the European Dream,” is a bold artistic attempt to demand the liberation of colonial history and its respecWLYHFRQVHTXHQFHV,WLVEROGLQWZRZD\VRQRQHKDQG LWGLVSOD\VDVHOIUHYHDOLQJRSHQQHVVWKDWXQÁLQFKLQJO\ UHÁHFWVWKHSV\FKRORJLFDOWUXWKWKXVUHQGHULQJLWYXOQHUDble; and on the other, there is the existential fear of Zevallos and Avellaneda of returning to Peru, due to the unforeseeable consequences that this project may have for them in their homeland. 7KH,QVWLWXWHRI,QWHUQDWLRQDO5HODWLRQVLQ6WXWWJDUW under the direction of Hermann Pollig, had good reason WRH[SHFWUHDFWLRQVRIH[WUHPHYLROHQFHIURPWKHSXEOLF,W LVWKHÀUVWVWRSRQWKHWKUHHDUWLVWV·WRXULQJH[KLELWLRQDQG series of conferences and performances. Their itinerary will continue on to the Museum of Bochum, the Badischer .XQVWYHUHLQ.DUOVUXKHDQGWKH.QVWOHUKDXV%HWKDQLHQ in Berlin. “Every culture represents a unique and irreplaceable body of values. The assertion of cultural identity therefore contributes to the liberation of peoples. Conversely, any form of domination constitutes a denial or an impairment of that identity.” These words are found in the 1982 UNESCO Declaration issued in Mexico City by the representatives of the industrialized countries of Europe. To the thousands of people who have been disappeared by political powers, those who no longer have a voice to tell us what actually happened. The exposition Todesbilder>,PDJHVRI'HDWK@RIWKH *UXSR&KDFODFD\RDWWKH,QVWLWXWHRI,QWHUQDWLRQDO5HODWLRQV in the city of Stuttgart is a cry for justice. Those who view it with eyes bulging in terror will wish from the bottom of their hearts for this European dream to end and for EuroSHDQGUHDPHUVWRZDNHXS ,IWKHLQWHQWLRQRIWKHH[KLELWLRQ·VRUJDQL]HULQ EULQJLQJWKHVHJKDVWO\KRUULÀFLPDJHVEHIRUHRXUH\HV was to truly give life to those referred to in the catalogue’s dedication, then furrows have been plowed in our feelings of wellbeing and our sleep-numbed spirits. Regardless of how hardened your heart might be, this attempt to incite shame in us deserves to be carried out over and over. +HUPDQQ3ROOLJRIWKH,QVWLWXWHRI,QWHUQDWLRQDO 5HODWLRQVLQ6WXWWJDUWLVRQHRIWKHIHZSHRSOHZLWKVXIÀcient power and resources to do just that, although not always successfully. He shows us these Todesbilder >,PDJHVRI'HDWK@LQKLVH[KLELWLRQKDOOVJLYLQJXVWKH FKDQFHWRYLHZGHDWKDQGLWVWKRXVDQGH\HVORRNLQJEDFN at us through these paintings, photographs, box-objects, and drawings by the Grupo Chaclacayo, made up of Helmut Psotta, Sergio Zevallos, and Raúl Avellaneda. 7KXVWKH,QVWLWXWHRI,QWHUQDWLRQDO5HODWLRQV³LQ terms of our fragile “relations” with the rest of the world— if in the forum for cultural exchange might change our perturbed position with regard to death, it would offer another form of development aid. So said Hermann Pollig during the opening of this exhibition on death. About the sanitized, repressed form in which we address death here in Europe, and the banal way it is treated by others; about the way we relate to it and WKHGLIIHUHQWIRUPVLQZKLFKGHDWKJLYHVXVOLIH+HVSRNH of the “dis-embourgeoisement” of death, and quoted the English sociologist Geoffrey Gorer, who chose to title one of his essays “The Pornography of Death.” With regard to “Death-Style” it was the speech, as well as other monstrosities of our “images” of death. +HUPDQQ3ROOLJ´,XQGHUVWDQG7RGHVELOGHU>,PDJHV of Death] to be the uncomfortable images offered to us ,IWKHVHDUWLVWVORFNWKHPVHOYHVXSLIWKH\ÁHHIURPWKH forces that subjugate them, it is for purposes of development, through distance and experimentation, interrogating themselves and arriving at their artistic responses: a sort of therapy for them and for this society suffering from the XQLPDJLQDEOH,IZHKDYHWKHFKDQFHWRH[SHULHQFHWKDW VWUXJJOHZKLFKLVQRWH[HPSWRIULVNVWRWKHDUWLVWV·OLYHV that battle for freedom, that raging against violence, terror, and fear, in the form of an artistic image displayed at an exhibition, then the question arises about how much potential our artists have for humanity, justice, and solidarity through their almost unprecedented dispute over the formulation of life in images, if no public reactions are elicited. The ideal situation would be the visible impact of our artists everywhere this exhibition is presented in the German Federal Republic, in a sign of solidarity with their Latin American colleagues, supporting their expression of impotence. This exhibition should lead one to experience something VLJQLÀFDQWSHUKDSVQRWYHU\EHDXWLIXOEXWVRPHWKLQJWUXH and inhumane. To cite Pollig: “Visiting the exhibition, you ZLOOEHFRQIURQWHGZLWKUDGLFDOSURFHVVHVRIGHP\VWLÀFDWLRQ ZLWKVODQGHURXVSURYRFDWLRQVEURNHQWDERRV7KHFURVV &KULVWLDQP\WKVPHWDSKRUVDQGULWHVHFFOHVLDVWLFDOP\VWLÀcations and idols of identity, such as Saint Rose of Lima, are used along with symbols of violence and subordination. Sexual symbols do not represent pleasure; they are sen- sorial images of the violence exerted and suffered.” The painful search for forms of dialogue with oneself and with VRFLHW\ ZKLFKRXUDUWLVWVVHHNRXWFRQVWDQWO\ VRYLWDOWR an artist, appears here in the form of augury; it is possible to read, to see, to share the life of the oppressed. ,QFRQYHUVDWLRQVZLWKWKHDUWLVWVLWLVSRVVLEOHWR perceive a constant fear of the consequences of this exhibition. The return to Peru after this event will not be problem-free, especially if there is no clear reaction to it here in Europe, if they are confronted with the reality that their struggle for the Peruvian people is not important to Europeans, that there is no interest in learning or seeing in Europe. Oh, how true! Sergio Zevallos wrote, under the title “The Obscene Death / Peru 1982–1989 – The Womb of Evil for My Painting”: 1RZDGD\VEHLQJ3HUXYLDQPHDQVÀUVWRIDOOJURZing up in a country where constant threat —which completely determines the meaning of life of each individual— LVXVHGDVDPHWKRGRIRIÀFLDOFRQWURODIDFWWKDWXSXQWLO now has been accepted with resignation by the majority. But this means having to bear unarmed the drastic moral decadence of society, the terrible consequences of which are translated into a freedom to murder, to massacre unscrupulously and even with political legitimation. Growing used to banal deaths, planned with full intention or resulting from laughable errors that could have been avoided… The aggressions are so many and so enormous; their only purpose is to turn the meaning of existence into precisely the contrary. Simply put, this is objective and historical proof: we live mixed in with death in a mortal promiscuity. Death constantly forces us to visually consume heaps of cadavers that become the lead actors in a grotesque “Human Tragedy,” exposing their uncomfortable presence to our even more indecent eyes: the horrifying scenario of an ordinary life, betrayed and disappeared in this irrational trip through history. A nightmare in real life is formed from the nightmare of an exhibition. 145 Dorothee Hackenberg, “‘Diese Brutalität der Sanftheit’: Interview mit Helmut J. Psotta, Raúl Avellaneda, Sergio Zevallos von der Grupo Chaclacayo über ‘Todesbilder’,” TAZ, Berlin, 26 January, 1990, pp. 22—23. THE BRUTALITY OF A SOFT TOUCH ,QWHUYLHZZLWK+HOPXW3VRWWD5D~O$YHOODQHGDDQG Sergio Zevallos of the Grupo Chaclacayo on “Todesbilder” [“Images of Death”] 2QWKHRXWVNLUWVRI&KDFODFD\RDVPDOOWRZQLQWKH$QGHV WKHUHLVRQHODVWKRXVH6RPHWLPHDJRLWZDVXVHGE\D 3HUXYLDQ*HQHUDOWRWKURZVXPSWXRXVEDQTXHWV1RZWKH house is rented out by the Goethe Institute as a studio IRUDJURXSRIDUWLVWV+HOPXW3VRWWDDYLVLWLQJSURIHVVRU DWWKH6FKRRORI$UWRIWKH8QLYHUVLGDG&DWyOLFDGHO3HU~ KDVZLWKGUDZQWRWKHPLGGOHRIDGHVHUWHGPRXQWDLQVLGH ZLWKWZRRIKLV3HUXYLDQVWXGHQWV6HUJLR=HYDOORVDQG 5D~O$YHOODQHGD 7KHDUWLVWLFUHVXOWVRIWZR\HDUV·ZRUNLQFOXGLQJSDLQWLQJV installations, and photos of performances carried out in WKH$QGHVZHUHH[KLELWHGLQDWWKH0XVHRGH$UWHGH /LPD/DWHUWKDQNVWRWKHVXSSRUWRIWKH*HUPDQ(PEDVV\ the Goethe Institute, the DAAD Berlin Artists’ Program, DQGWKH0LQLVWU\RI)RUHLJQ$IIDLUVLQ%RQQWKHH[KLELWLRQ ZDVEURXJKWRYHUWR(XURSHWRWKH)HGHUDO5HSXEOLFRI *HUPDQ\%HUOLQLVWKHODVWVWRSDIWHU6WXWWJDUW%RFKXP DQG.DUOVUXKH taz: 7KHZD\\RXWKUHHSXWLW3HUXUHSUHVHQWVWKH´HQG RIWKH(XURSHDQGUHDPµ+DYHZHUHDFKHGWKHHQGRIWKH European dream, and thus the end of the continent’s LQÁXHQFH" Helmut Psotta: For me, as a European, Peru is a paradigPDWLFFDVHRIÀYHKXQGUHG\HDUVRIFRORQL]DWLRQ)LYH hundred years of wealth, and always that violence in the name of a predominant moral system or Christianity. The pillaging, the will to dominate, for us Europeans, is a mentality that is fully developed by now. We can see it still in Berlin and the Federal Republic of Germany (BDR): everyWKLQJWKDWLVOLEHUDWHGLVRQFHDJDLQRFFXSLHG,W·VWKH GUHDPRIWKHGLVSODFHPHQWRIWHUULWRULHV:KDWXVHGWRWDNH SODFHWKURXJKWKH&KXUFKQRZKDSSHQVYLDWKHEDQNVRU the politicians, although more subtly, of course. But little E\OLWWOHZHDUHZDNLQJXSGLVLOOXVLRQHGWKDQNVWR3HUXYLDQ reality. Raúl Avellaneda: The legacy of European culture in Peru is completely decadent: the humblest Peruvians don’t even KDYHFOHDQGULQNLQJZDWHURUHOHFWULFLW\ Psotta: Lima is home to San Marcos, the oldest SpanishIRXQGHGXQLYHUVLW\LQWKH$PHULFDV,KDGDOZD\VLPDJLQHG it would have an outward appearance that was passable, at least. But what you see there is a cancer ward: 60% of LWVVWXGHQWVDUHPDOQRXULVKHG,WKDVGHWHULRUDWHGQRWLFHDEO\WRWKHSRLQWWKDWLWORRNVOLNHDVFHQHMXVWDIWHUDQDLU raid. They don’t receive one cent in subsidies, and the FDPSXVLVFRQWUROOHGE\WKHSROLFH,IWKH\ÀQG\RXZLWK DERRNE\0DU[RU0DUFXVHDW6DQ0DUFRV\RX·UHLPPH diately tortured, disappeared, or murdered. This is just one example of how the end of the European dream is bearing witness to things that Marx would probably have never been able to imagine. Avellaneda: %XWZH·UHWDONLQJQRZDERXWDUWDERXWKXPDQ LQWHUDFWLRQ3ROLWLFDOO\WKLQJVDUHPRUHFRPSOLFDWHG,I3HUX KDGDUHYROXWLRQULJKWQRZOLNHWKHRQHLQ5RPDQLD>@ we would have practically no culture that stands on its own. All we have is a European language. DUPHGJURXSV ZHUHQ·WVRSUHYDOHQW\HW,WZRXOGEHLPSRVVLEOHWRGRLWQRZDGD\V7KDWVODQGHURXVDUWLFOHVDLG´,I WKHVHER\VKDGVKRZQWKHLUZRUNKHUHWKH\ZRXOGKDYH been put on trial.”3,QVXFKDORDGHGVLWXDWLRQDUWKDVDQ explosive quality. Psotta: ,W·VUHDOO\DWHUULI\LQJYLFLRXVFLUFOH,WPD\EHWKDW you can only resolve this psychologically, on an individual OHYHOMXVWDVZHDUHVHHNLQJWRGRDVDJURXS +RZHYHUWKHH[KLELWLRQLQ/LPDZDVDEVXUGO\FHQVRUHG E\WKH*HUPDQGHOHJDWLRQ:KDWZDVLWWKDWWKH\ZHUHVR FRQFHUQHGDERXW" 7KHWKUHHRI\RXZRUNLQVHULHVWKDWUDQJHIURPWR SLHFHVRQDVLQJOHWKHPH,VWKLVEDVHGRQDVHDUFKIRU the best possible solution, or is it rooted in a task that RFFXSLHV\RXREVHVVLYHO\" Psotta7KH*RHWKH,QVWLWXWHKDVDFHUWDLQIUDPHZRUNZLWKin which it can act, and the current director has to accept certain conditions of a political nature. An ambassador or a cultural attaché has the ability to veto a project. At that WLPH)-6WUDX‰ZDVJRLQJRQDERXWKRZWKH*RHWKH,QVWLWXWHVZHUHFORVHO\OLQNHGWRWKHOHIWHWF2XUSURMHFWZDVQ·W DWWHPSWLQJWRFRPPHQWRQ*HUPDQIRUHLJQSROLF\,WZDV brutal when this cultural attaché came along with his pencil all sharpened and told us that this or that had to go, that such-and-such was pornography. But that didn’t happen ZLWKDQ\RIP\ZRUNVWKH*HUPDQVFDQ·WFHQVRUD*HUPDQ in Peru, but they can censor Peruvians. So we decided to FRYHUXSDQ\WKLQJLQFULPLQDWLQJZLWKEODFNFORWK%\EODFNing everything out, we were following the tradition of censorship, but the cloth was immediately snatched off by the SXEOLF:HDOUHDG\NQHZWKDWZDVJRLQJWRKDSSHQ7KH absurd part was that the Peruvian authorities didn’t react. Even the [German] Ministry of Foreign Affairs had to write letters of apology due to the suspicious actions of its RIÀFLDOVDQGWKHQWKH\ÀQDQFHGWKHH[KLELWLRQDQGEURXJKW LWRYHUKHUH:KLOHWKH\ZHUHWUDQVSRUWLQJWKHZRUNVRYHU here, the German Embassy started to collaborate again. All of these contradictions are very strange; they, too, are part of the European dream. Psotta: ,W·VDQREVHVVLRQ*RHWKHZURWH´,GRQ·WNQRZ\HW how to say it, given that my word does not yet exist.”1 You feel so psychologically dominated by all of this that you VHHNRXWWKHPRVWDFFXUDWHH[SUHVVLRQ7KHKRSHLVWKDWDW VRPHSRLQW\RXÀQGDYDOLGZD\WRH[SUHVVDOOWKLVRXWUDJH OLNHDORFNEHLQJRSHQHGOHWWLQJORRVHDWRUUHQWRILPDJHV This is therapy. But, of course, there is a criterion of quality. ,W·VQRWOLNH\RXMXVWYRPLWLWDOOXSDQGKDQJLWRQWKHZDOO When we show these things publicly, we select the best SLHFHV,QWKDWVHQVHDOORIRXUSLHFHVWDNHQDVDZKROH DUHZRUNVRIDUW Is it possible to imagine, at some point, a theme other than ´7RGHVELOGHUµ>´,PDJHVRI'HDWKµ@" Avellaneda: 1RWIRUPH,FDQ·WOLHRUKLGHWKLQJV 7KDWPHDQVWKDWH[WHUQDOFRQGLWLRQVZRXOGKDYHWRFKDQJH <RXUKRXVHLQ3HUXZDVVHDUFKHG>E\WKHSROLFH@RQPRUH WKDQRQHRFFDVLRQ,W·VQRORQJHUSRVVLEOHWRLVRODWHRQHVHOI IURPWKHVRFLDOUHDOLW\ :KDWGR\RXPHDQE\\RXUVHOIGHVFULEHGVWDWXVDV ´SURKLELWHG(XURSHDQVµ" Avellaneda:HFDQ·WJREDFNHLWKHUEHFDXVHLQ3HUX we’re persecuted by the press and the police. Sergio Zevallos: We live in a world dominated by European norms: language, ideology, religion. “Prohibited” means WKDWZHFDQQRWZDONWKHVDPHSDWKEHFDXVHZHDUHSROLWLcally, psychologically, and emotionally suppressed. You feel a longing to express this terrible situation, and only through WKHLQÁXHQFHRID(XURSHDQLVLWSRVVLEOHWRRYHUFRPHWKLV aphasia. There is no other path; the old ways have all been buried. [Have you been persecuted] since you’ve been living DEURDG" Psotta: :H(XURSHDQVPXVWJLYHEDFNWRWKHPZKDWZH WRRNDZD\DORQJWLPHDJRVHOIFRQÀGHQFH7KHSURSDJDQGD KHUHWUHDWV6RXWK$PHULFDQVOLNHH[RWLFVSHFLHVRUSDUURWV but Peru is a country that was once European territory. You can see that wherever you go. Psotta: Even here, people have tried to interrogate the GLUHFWRURIWKH.QVWOHUKDXV0LFKDHO+DHUGWHUDERXWXV There are slanderous publications in Peru that claim the most unimaginable things; for example, they say we’re subversives. They go so far as to claim that the German federal institutions that support the project are subversive, too.2 The exhibition in Lima [in 1984] was a huge enough ULVNDOUHDG\:HZDQWHGWRGLVSOD\RXUZRUNLQRQHRIWKH largest museums —there are only two of them— and we ZHUHDEOHWRGRWKDWWKDQNVWRWKHVSRQVRUVKLSRIWKH *RHWKH,QVWLWXWH7KLVZDVEHIRUHWKHHOHFWLRQVDQGDWWKDW time, subversive actions (by the Shining Path and other What’s behind the violent reaction on the part of the 3HUXYLDQSUHVV" Avellaneda,WKLQNWKHSROLWLFDOVLWXDWLRQKDVEHFRPH completely radicalized. There are going to be elections soon, and naturally the extreme right wants to set itself up with [Mario] Vargas Llosa.4 So this exhibition, organized by Peruvian critics and supported by the Germans, was naturally an enormous provocation. Zevallos: ,Q%RFKXPD&]HFKPDQ>WROGXVKH@ZDQWHG WRWDNHWKHH[KLELWLRQWR3UDJXHEHFDXVHKHIHOWDQDIÀQLW\ with the revolutionary social movement. But he was afraid WKDWSHRSOHLQ3UDJXHZRXOGQ·WWDNHLWZHOOVLQFHHYHU\one’s got their own agenda. 146 Are the “Todesbilder“[“Images of Death”] perfectly export DEOHPHWDSKRUVIRUHYHU\WKLQJRUGRWKH\UHIHUVSHFLÀFDOO\ to a very Peruvian problem: the exaggerated fusion of &DWKROLFLVPZLWKSROLWLFDOUHSUHVVLRQ" Psotta: ,WKLQNWKLVWRRLVLPSRUWHG(XURSHDQFXOWXUDO heritage. For example, Saint Rose of Lima; she really did ÁDJHOODWHKHUVHOIWRGHDWKDWWKHDJHRI$QGVKHZDV elevated into an ideal, the ideal of suffering right up to the end as a form of penitence, as an absolute need to achieve absolution. We all carry these Saint Roses inside of us. [The German Christian theologian] Uta 5DQNH+HLQHPDQQLVSHUVHFXWHGE\WKH&KXUFKIRUWHOOLQJ very straightforward truths. The same goes for the Liberation Theology people, who are simply excommunicated. The Catholic Church has never been as reactionary as it LVQRZ>3RSH.DURO-R]HI@:RMW\OD>-RKQ3DXO,,@FRXOGEHD chemical company representative: he does an incredible job personifying the brutality of a soft touch. On the other hand, the degree of willingness to suffer that exists in Peru, consoled by a belief in life after death, is unimaginable. That also plays into the appearance of a Saint Rose and WKHLGHDORIVHOIÁDJHOODWLRQ Avellaneda: Or Christ, always depicted as a cadaver. The more wounds, the better. Psotta: /LNHDPDSRIZRXQGV$QGWKRVHFRPSOHWHO\ corroded wooden sculptures are all Europeanized. They even have blond European wigs. For that, there’s money to go around, to light up a church and all its decorations, while right next to it there are stretches of desert where people don’t even have water or a place to live. $QGWKHSHRSOHEHOLHYHLQWKLV" Avellaneda:7KH\·UHORRNLQJIRUVRPHWKLQJWRDWWDFKWKHLU souls to. For example, the procession of the Lord of Miracles. Masses of people move through the streets; they moan and complain the same way they have for hundreds of years. :LHODQG6FKPLHGZURWHWKDWWKH&KXUFKKDVFRYHUHGWKH ZKROHVXEMHFWRIVH[LQVKDPHDQGWKXVWKHVXEMHFWRI YLROHQFHKDVEHFRPHVRPHWKLQJQHXWUDO,QRQHRI6HUJLR·V essays, he talks about the lack of shame over everyday PXUGHUVDERXWWKLV´REVFHQHGHDWKµ 147 Psotta: ...Methodic madness. A Minister of State persoQDOO\VKRRWVSROLWLFDOSULVRQHUVDQGWKHQH[WGD\KHNQHHOV GRZQLQKLVQLFHFOHDQVXLWQH[WWRWKH3RSH>-RKQ3DXO,,@ )RUWKDWYLVLWDPDOOZDVGHFRUDWHGLQLPLWDWLRQRIDQ,QFDQ fortress. And before the Pope came, the minister married his wife in a religious ceremony, because there’s a statute that says that you can’t greet the Pope with your common-law wife. Avellaneda: And these people want to tell us what’s pornographic. ,QPDQ\RI\RXUDFWLRQV\RXSOD\ZLWKWKHÀJXUHRIFKXUFK GLJQLWDULHVDQG&DWKROLFULWHVIRUH[DPSOHZLWK*RRG )ULGD\ Psotta: The whole Good Friday liturgy is a true drama, a W\SHRIWKHDWHUWKDWKDVIDVFLQDWHGPHVLQFH,ZDVDFKLOG ,WSUHVHQWVDGUDPDWL]HGYHUVLRQRIKRZWRGLHDQGKRZ to suffer tremendously, to resist death, to convert it into a metaphor. Avellaneda: 7KLVIDVFLQDWLRQKDVDORWWRGRZLWKORRNLQJ at things with tenderness, with humanity. Addressing these themes doesn’t mean you’re carrying around this violence within yourself. For example, the way Helmut positioned WKHIDEULFWRPDNHDGUHVVLQWKHSHUIRUPDQFHWKDWSHDFHful atmosphere. Or maybe, as Leonardo says, the most beautiful things become even more beautiful when they DUHUHÁHFWHGLQWKHXJOLHVWRIWKLQJV Even in the “Todesbilder” [“Images of Death”], there is a VHDUFKIRUEHDXW\ Psotta: %HDXW\LVDOVRDIRUPRISURWHFWLRQ,QRUGHUWR ZLWKVWDQGWKHFRQÁLFW,VHDUFKIRUVRPHWKLQJSOHDVXUDEOH or at least a balance. The Viennese Actionists let real blood ÁRZLQRXUFDVHLW·VWKHDWULFDOEORRGÀFWLRQ:KHQ\RX have enough of a spiritual connection to the theme and the artistic potency necessary, you can depict it clearly, in such a way that it is both horrifying and beautiful at the same time. And this beauty does not mean that the theme of death is going to be played down. Zevallos: ,WDOVRLQYROYHVDSURIRXQGUHVSHFWIRUWKHPDWHrial, the medium, which in turn means respect for people… ZKLFKGRHVQ·WH[LVWLQWKHDFWXDOVRFLRSROLWLFDOFRQWH[W Zevallos: Power situates itself up above us, with a clean face, when in truth it commits crimes. Down below, nothing LVVHFUHWFULPLQDOV·QDPHVDUHFRPPRQNQRZOHGJHEXW nothing is done. Very normal human relations are lived out. That’s schizophrenic. Zevallos: ,KDYHWRGHDOZLWKREMHFWVWKDW,ÀQGGLVJXVWLQJ WRREHFDXVH,NQRZWKHVWRU\EHKLQGWKHP,KDYHWREH conscious of them and allow myself to be possessed by WKHHVVHQFHRIWKRVHREMHFWVLQVXFKDZD\WKDW,WUHDW them as people. 7RZKDWH[WHQWKDYHWKHWKUHHRI\RXVXFFXPEHGWR Romantic images, to the Western topos of a longing for GHDWKDVZLWK>*RHWKH·VSRHP@7KH(UO.LQJ>)UDQ] 6FKXEHUWPXVLFFRPSRVLWLRQ@'HDWKDQGWKH0DLGHQHWF" NOTES Zevallos: :HZHUHMXVWWKLQNLQJDERXWLQFOXGLQJWKRVH songs. 2 He is referring to the article by Luis Lama. See Luis Lama, “Perversión y complacencia,” Caretas, Lima, 20 November 1989, pp. 74 -76. (Editor’s note). Psotta: But where do you see anything Romantic in us? ,W·VDOZD\VVDWLULFDO6RPHWLPHVF\QLFDO Avellaneda: We’re always on the edge of beauty, but you have to add a bit of ugliness. That turns things upside down. :KDWGRHVNLWVFKPHDQWR\RXDVDPRGHOIRU\RXUZRUN" Avellaneda: :HXVHZKDWZHÀQGGROOVLQWKHWUDVKVPDOO religious images left in the street, and even images of WRUWXUHWDNHQIURPQHZVSDSHUFOLSSLQJV0DQ\RIWKHVH images are so internalized among the population that the FODVVLFPRWLIVDUHLQÀOWUDWLQJWKHPVHOYHVRQFHPRUHIRU example, Jesus with blond hair and blue eyes. And people light votive candles in front of these images. The little 0DU\DQG-HVXVÀJXUHVVKRXOGQ·WEHWKURZQLQWKHWUDVK WKH\VKRXOGEHWDNHQWRWKHFHPHWHU\7KHUH\RXFDQVHH WKRXVDQGVRIGLIIHUHQWWLQ\HIÀJLHVRI-HVXVDQG0DU\ headless and burnt. This, by the way, is big business in Peru, selling these miniature images. 1 Literal translation of Psotta’s SDUDSKUDVLQJ,WKDVQRWEHHQ possible to determine the original quote in question. (Translator’s note). 3 The exact phrase from the article reads, “Maybe these boys did the right thing by not exhibiting their version of Peruvian violence ‘for export’ here, because if they had, they would have gotten themselves into a real mess.” Lama, “Perversión y complacencia”, p. 76. (Editor’s note). 4 The writer Mario Vargas Llosa —winner of the 2010 Nobel Prize for Literature— ran for president of Peru LQEDFNHGE\WKHFHQWHUULJKW liberal and conservative political alliance Frente Democrático )UHGHPR ,QWKHHOHFWLRQV9DUJDV Llosa lost to Alberto Fujimori, who later staged a self-coup in 1992 and turned his government into a dictatorship that lasted until 2000. (Editor’s note). 7KHSRHP(UON|QLJ>7KH(UO.LQJ@ by German writer Johann Wolfgang von Goethe has been used by many FODVVLFDOFRPSRVHUV7KHEHVWNQRZQ one is Franz Schubert’s rendition, Opus 1 (D. 328). The poem, published in 1782, depicts the death of a child assailed by a supernatural being, the Erl-King. Der Tod und das Mädchen [Death and the Maiden] D. 531, Op. 7, No. 3, is a song composed by Franz Schubert in February 1817. The text is derived from a poem written by German poet Matthias &ODXGLXV,QWKHSRHPWKH0DLGHQ says: “Pass me by! Oh, pass me by! / *RÀHUFHPDQRIERQHV,DPVWLOO young! Go, rather, / And do not touch me / And do not touch me”. And the Death replies: “Give me your hand, \RXEHDXWLIXODQGWHQGHUIRUP,DP a friend, and come not to punish / %HRIDJRRGFKHHU,DPQRWÀHUFH Softly shall you sleep in my arms!” (Editor’s note). Dorothee Hackenberg, “Heilige Folter—Rosa!: Performance und nationale Inszenierungen eines peruanischen Symbols,” TAZ, Berlin, 26 January, 1990, p. 23. HOLY TORTURE-ROSE! Performance and staging of a Peruvian national symbol A chapel impregnated with Catholicism, elevated to surreal extremes. Above the altar hangs a bundle (a cadaver?), painted red, in the middle of showy, smiling portraits of a Peruvian General. On the stairs, a bouquet of red carnations hygienically covered in plastic, and on the ground, WKH3HUXYLDQÁDJORQJSURFHVVLRQDOFORWKVLQUHGEODFN and white.1 For those observing the performance from the EDOFRQ\RIWKHFKDSHO>RIWKH.QVWOHUKDXV%HWKDQLHQ@ DZLGHFRIÀQKDVEHHQVHWLQWKHIRUHJURXQGDPRQVWURXV object containing the swollen members of a man and a woman, a tangle of straw, cloth, and other everyday materials, relics from a previous action. The visitors participate with a natural air in this installation depicting a violation, GULQNLQJIURPWZRZLQHJODVVHVÀOOHGZLWKDEORRGUHGOLTXLG Could they have contained real blood inside? For a long time, nothing moves, until each of the accessories gradually comes into play: the nude victim buttons up the murderer’s shirt, and he then ties her to a chair before the altar, her legs washed with a blood red liquid, a crown of roses tied to the curls in her hair. Although the crown is overlarge for the cadaver’s face, it perches perfectly above the white PDVNZLWKDEURDGVPLOHDQGRSHQPRXWKLQVLGHZKLFKD OXVW\WRQJXHPD\EHVHHQÀGJHWLQJ The performance plays with one of the recurring leitmotivs of the Grupo Chaclacayo: the worship of Saint Rose of Lima. The Peruvian patron saint —sometimes depicted with an anchor and the baby Jesus, but always with a crown of roses fastened to her nun’s veil— was a young indigenous girl2ZKRWXUQHGKHUEDFNLQGLVJXVWRQWKHVSLULWXDO and worldly licentiousness of the upper classes of sixteenth- and seventeenth-century Lima, venting her erotic longings through the ecstatic adoration of the Catholic VDYLRUZKLFKWRRNWKHIRUPRIDGHVLUHIRUGHDWKDQGWKH self-mutilation of her body. This demonstrably beautiful woman rejected men right up until her early death, only to be subsequently profaned and violated: not only were her members destroyed by the masses during her funeral, but —according to the artist H. J. Psotta— her image hangs today in every police station in Peru, settings for interrogations and torture. For the 400th anniversary of the saint’s birth, President Alan García Pérez bestowed upon her the nation’s most prestigious distinction, “The Order of the 6XQµLQWKHSUHVHQFHRI3HUX·VKLJKHVWUDQNLQJPLOLWDU\ DQGSROLFHRIÀFHUVWKHSDSDOQXQFLRDQGELVKRSVDVZHOO as Willy Brandt, just four days after the mass execution of SROLWLFDOSULVRQHUVE\JURXSVOLQNHGWRWKHJRYHUQPHQW Saint Rose of Lima had to abandon her true identity LQRUGHUWREHFRPHWKHLUUDWLRQDOÀJXUHRIZRUVKLSE\WKH IDVFLVWFOHULFDOFDVWFXUUHQWO\LQSRZHU,QWKH(XURSHDQL]HG SLFWRULDOWUDGLWLRQRI3HUXKHUVNLQKDVEHHQGHSLFWHGHYHU whiter, and her characteristics have become increasingly NLWVFK\+HUSDVVLRQDWHUHMHFWLRQRIHDUWKO\ORYHEHFDPHD sort of lascivious restraint, and while the mystic portrayed LQ´6DLQW7HUHVD>RI$YLOD@µE\>WKH,WDOLDQVFXOSWRUDQGSDLQWHU Gian Lorenzo] Bernini is shown in the midst of ecstasy, the DGDSWHGGHSLFWLRQRI>,WDOLDQVFXOSWRU@0HOFKLRUUH&DIID·V “Saint Rose” is dominated by the undisguised exhibitionism RIDEHLQJODFNLQJDOOVHOIZLOO Today, Saint Rose —who, according to a Lexicon of “German” Saints, demonstrated such self-control that VKHGLGQ·WPDNHDVRXQGDIWHUKDYLQJRQHRIKHUÀQJHUV amputated— is the patron saint of the wounded, of women LQODERUDQGRIIDPLO\DUJXPHQWV,QRWKHUZRUGVWKH perfect purgative for the secondary effects of torture, rape, and death. For all other cases, Peruvians now have a well where legend has it that Saint Rose, acting as an “exemSODU\VDGRPDVRFKLVWWKUHZDZD\WKHNH\WRKHUFKDVWLW\ belt.” Centuries later, “Lima’s most devout residents pour out their innermost desires here,” according to Sebastián Gris, the sociologist cited by H. J. Psotta. “Combined together in her holy image, torture and repression form a complex synthesis of our urban psychology. The other face, the other disowned body of Saint Rose is doubtlessly La Perricholi, extremes derived from the same repressive attitude. (…) But Saint Rose as part and symptom of a given order is also a cathartic element here, allowing the artist to act out an extreme disclosure and, possibly, a higher level of questioning.”3 6HULHVRIÀIW\RUPRUHZRUNVRQWKHVDPHWKHPH are the result of this search for catharsis, the need for redemption on the part of an individual who refuses to JLYHXS,QWKHSHUIRUPDQFHWKHSDLQWLQJVFORWKVERGLHV DUGHQWDULDVRIWKH$YH0DULDYHLOVÁRZHUVDQGUHGFORWKV mutually complement each another to the limit of psychological tolerability, repetitively extended in time. There is no provocation aimed at the spectators, but rather a compulsive need, the treatment of a trauma. The nudity is not understood as a voyeuristic spectacle, EXWUDWKHUDFRQVHFUDWLRQWRZDUGGHDWK,QVLOHQWFRQVHQW though without any sort of preplanned agreement, the group consummates all the steps necessary for an improvised ritual. The victim is placed on repeated occasions in the appropriate pose, with the crown of rose thorns around KHUQHFNSURIDQHGZRXQGHGVKHIRUQLFDWHVZLWKWKHFKDLU ODLGIDFHGRZQRQWKHÁRRUDQGFDUHIXOO\GHFRUDWHGZLWK VWUHDPHUVZKLOHWKHZKLWH3HUXYLDQPDVNZLWKLWVLURQLF VPLOHDGRUQVDFURVV7KHSODVWLFSLQNKHDUWVKDSHG FXVKLRQVZLWKWKHLQVFULSWLRQ´,FKOLHEH'LFKµ>´,/RYH<RXµ@ DUHFDUHIXOO\LQÁDWHGWKHDVKHVGLVSHUVHGRYHUWKHYHLOV and the cloths folded with devotion: funeral rites. 149 Michael Nungesser, “Gebärmutter des Bösen: Die peruanische Gruppe Chaclacayo im Künstlerhaus Bethanien,” [unidentified newspaper], Berlin, 6 February, 1990, p. 5. NOTES THE WOMB OF EVIL The Peruvian Grupo Chaclacayo at the Künstlerhaus Bethanien 1 Red and white are the colors of 3HUX·VÁDJ (GLWRU·VQRWH  2 Saint Rose was mestizo, not indigenous. (Editor’s note). 3 Both quotes from the author Sebastian Gris (pseudonym of the critic Gustavo Buntinx) have been translated from the original Spanish. See Sebastian Gris, “An Extreme Experience in Our Art,” El Caballo Rojo, supl. El Diario Marka, August 28, 1983, pp. 10-11. (Editor’s note). Beliefs and superstitions, oppression and exploitation, violence and desperation are depicted in the complex H[LVWHQWLDOWKHPDWLFIUDPHZRUNSURFHVVHGZLWKSDVVLRQDWH expressiveness by the Peruvian Grupo Chaclacayo in their VKDUHGDUWLVWLFXQGHUWDNLQJV7KHOLIHDQGZRUNVRIWKHVH three artists are intertwined, along with the aesthetic levels of drawings, actions, performance, and installations. The German Jewish artist Helmut J. Psotta, who taught in Lima at the School of Art [of the Universidad Católica], and his two students, Raúl Avellaneda and Sergio Zevallos, PRYHGDWWKHEHJLQQLQJRIWKHVWRWKHRXWVNLUWVRI the small Andean town of Chaclacayo, where they lived DQGZRUNHGRQWKHLUDUWLVWLFSURMHFW 7KHH[KLELWLRQDWWKH.QVWOHUKDXV%HWKDQLHQ includes photographic documentation of the three artists’ DFWLRQVZKLFKDORQJZLWKRULJLQDOZRUNVDQGREMHFWVIRUP a macabre yet demystifying oeuvre. To understand this extensive group project —radicalized even further by the artists’ reclusion— it is necessary to understand the conTXHVWRIWKH,QFD(PSLUHE\WKH6SDQLDUGVZKLFKKDVFRQtinued to leave behind bloody traces right up to the present GD\,QWKHODVWIHZ\HDUVWKRXVDQGVRISHRSOHHVSHFLDOO\ those from indigenous populations, have been tortured and murdered for political reasons, without the perpetraWRUVIDFLQJDQ\NLQGRIOHJDOFRQVHTXHQFHV ´,PDJHVRI'HDWK´E\*UXSR&KDFODFD\RSUHVHQWV purposely provocative, often blasphemous, symbolicceremonial depictions in which birth, death, love, hate, and sexuality —in predominantly surrealistic forms— are SHUYHUWHGLQUHGDQGEODFNWRQHV7KHJURXS·VDFWLRQVKDYH been carried out in prison cells, cemeteries, and the street, UHÁHFWLQJWKHIXQHUDOULWHVRIWKH5RPDQ&DWKROLFOLWXUJ\ the Good Friday liturgy, and the myth and dogma of the ,PPDFXODWH&RQFHSWLRQDVZHOODVLPSURYLVDWLRQVRQ the “Passions of a Wandering Body” —an obscene version of the danse macabre performed by Zevallos in his hometown of Lima, “the womb of evil made reality.” 7KHJURXS·VZRUNLVLQQRGDQJHU,QKHDYLO\ armed federal police stormed their refuge, on charges of suspected “criminal” actions. After clearing up the PLVWDNHWKHXQLIRUPHGRIÀFHUVZHUHLQFOXGHGLQDSHU formance, machine guns and all; the photos are eerie. “Peru… A Dream” is the name given to the spectacle: a bitter, tragic irony. 151 Michael Haerdter, “Todesbilder: Peru oder Das Ende des europäischer Traums,” presentation of the exhibition Todesbilder, unpublished manuscript, Künstlerhaus Bethanien, Berlin, May, 1990. IMAGES OF DEATH: PERU, OR THE END OF THE EUROPEAN DREAM Three artists are now the subject of an in-depth retrospective. The German Helmut J. Psotta and his Peruvian students and colleagues Raúl Avellaneda and Sergio Zevallos withdrew for several years to the solitude of an Andean valley in Peru, in the town of Chaclacayo, where WKH\JDYHWKHPVHOYHVRYHUFRPSOHWHO\WRWKHLUZRUN7KH group was named after the town. This collection of drawings, objects, installations, PRQWDJHVDQGGRFXPHQWVLGHQWLÀHVWKHDUWLVWVDVDJURXS *UXSR&KDFODFD\RZKRVHZRUNVVSUDQJIRUWKIURPWKH intimate interaction of its members. Between 1989 and 1990, after leaving Peru, the artists recommenced their DUWLVWLFDFWLYLWLHVDWWKH.QVWOHUKDXV%HWKDQLHQLQ%HUOLQ and later in West Germany. 2XUH[KLELWLRQLVDQDOPRVWDUELWUDU\SHHNLQWRD ´ZRUNLQSURJUHVVµH[SUHVVLYHO\GRFXPHQWLQJWKHFRP SXOVLRQWRZRUNWKHSURGXFWLYLW\WRZDUGVHOIOLEHUDWLRQVR characteristic of the group. 7KH´,PDJHVRI'HDWKµFRQVWLWXWHD´PXVHXPRI REVHVVLRQVµ7KLVWHUPLVVWULNLQJO\DFFXUDWH,WUHIHUV above all, to the artists’ obsessions with their individual P\WKVPHPRULHVHPRWLRQVIHDUVFRQÁLFWVDQGULWXDOV but also to the European obsession with Latin America, the occupation of that continent throughout European history, and its obsession with violence. These intermixed internal and external realities combine into an inextricable whole, which—in short—is art. Therein lies the secret of its effectiveness. $UWFDQQRWEHUHDGOLNHJHQHUDONQRZOHGJHERRNV or an editorial column. However, it is possible to select and point out certain threads among the artistic morass, PDNLQJLWHDVLHUWRSDUVH 7KHUHLVYLROHQFHZKLFKDFWVOLNHDleitmotiv, impregnating the artists’ entire oeuvre. Violence as human heritage, starting with the expulsion from Paradise, Cain versus Abel, continually engendered among all peoples and in all countries up to the present, as seen on the daily news. Violence against dissidence, against orthodoxy, violence through fear, greed, sexual pleasure, ignorance and homelessness, violence of man against himself. Time and again: violence and sexuality, illicit sex that turns into violence, hate and violence as archetypes incarnated in the structure of humanity’s impulses, its eternal curse, violence which —merely hidden and repressed— dominates even our most enlightened societies... Violence, too, as an individual destiny of the artists of Chaclacayo: the Peruvian members have been surrounded by terror since their childhoods. This is the motivation behind love: the desire for XQLRQDQGUHDOL]DWLRQPDQLIHVWHGLQWKHV\PEROLFÀJXUH of Saint Rose. Four hundred years ago, in the corrupt Lima RIWKH6SDQLVKFRQTXHURUVWKHGDUNVNLQQHGPHVWL]R beauty lived out the madness of rebellion as Christ’s bride, until her young life was extinguished as the result of vioOHQFHSUDFWLFHGDJDLQVWKHUVHOI/LNHDJOHDPLQJZKLWH PDUEOHVWDWXHVKHZDVÀQDOO\LQFRUSRUDWHGLQWRWKH+HDYHQ of Roman saints: a colonial destiny. Psotta’s mother was also named Rose, a confusing coincidence… This is the paradigm of Peru: a beautiful, rich land that also sits between the borders of one of the most misfortunate countries under the sun. The mythical shadow RIWKHSRZHUIXODQGYLROHQW,QFDVWKHJROGRI&XVFRWKH silver of Potosí, eclipsed by the arrogance and brutality of the conquerors, an ancient vicious circle of oppression and H[SORLWDWLRQWKDWUHPDLQVXQEURNHQWRWKLVGD\ The motherland of Peru, desired and feared, loved and hated, where light and shadow combine with desire, contributing to the salvation of its people from hell and purgatory. Peru and its destiny become the natural center of JUDYLW\RIWKHLQGLYLGXDODQGFROOHFWLYHZRUNVRIWKHDUWLVWV of Chaclacayo. 7KHGHVWLQ\RI3HUXDOVRPHDQV(XURSH/LNHD PDJQLI\LQJJODVV(XURSHDQKLVWRU\FDQEHLGHQWLÀHGKHUH LQDQH[HPSODU\PDQQHU,QWKHYHU\OLYHVRIWKH´SURKLELWHGµ (XURSHDQV=HYDOORVDQG$YHOODQHGD,QWKH´OHJLWLPDWHµ European Psotta, the Peruvian parable of the European Holocaust from which his Jewish family escaped… Let us consider one of the threads of this complex universe of the “images of death”: the element of ritual. 7KHULWXDOEHFRPHVDVXLWRIDUPRUDUHPHG\IRUWKHZHDN After comprehending the threat of death and evil in the SHUVRQLÀFDWLRQRIWHUURULWLVSRVVLEOHWRGRPHVWLFDWH violence for oneself and defy the abyss. Action and performance are thus integral comSRQHQWVRIWKHDUWLVWLFVHOINQRZOHGJHDQGVHOIOLEHUDWLRQ of the Grupo Chaclacayo. Their performances become a modern version of the rites of mythical evocation seen in the dances of death, the danse macabre present since the very beginning of humanity. For us, as citizens of a highly-developed, industrialized country, the mere mention of death, and especially our own mortality, is taboo. When the hope for the technological conquering of death fails to become a reality, we VHHNUHIXJHLQLWVWRWDOQHJDWLRQ +HUHWKHDIÁXHQFHRIWKHLPDJHVE\WKHDUWLVWVRI &KDFODFD\RKLWVRXUVHQVLELOLWLHVLQSHUKDSVWKHLUZHDNHVW point. We Europeans are the vulnerable ones here, while the subject of death in Latin American societies has always been a public phenomenon. And not only in the sense of evil. For example, we may recall the poetic power of the tango of the Rio de La Plata and its songs. ,QWKHLUREVHVVLRQZLWKGHP\VWLI\LQJDQGEUHDNLQJ our taboos and repressions, the artists force us to face the painful truth in the forbidden room of our souls. 7KHDUWLVWVDOVREUHDNWDERRVLQRWKHUZD\V3HRSOH WDONRIDFHUWDLQSRVWPRGHUQSDUDSKUDVLQJRIPRGHUQLW\ which in these parts has become increasingly integrated into the international jargon of elegant scenes and art PDUNHWVZLWKDVWURQJWHQGHQF\WRZDUGDVVXPLQJWKHWDVN of interior decoration in our societies with their division of labor. The baroque expression, the explosive pathos of the three artists of Chaclacayo falls outside this “faceless internationalism,” to use the words of Klaus Honnef. ,QWKH´,PDJHVRI'HDWKµHWKLFVLVUHWXUQHG³LQD naïve but undoubtedly unique sort of way— to the point of PHUHDHVWKHWLF+HUHZHPD\ÀQGDQFLHQWIRUFHVDWZRUN such as enlightenment, accusation, rebellion; in short, this “force of negation” that was once the most distinguished characteristic of modernity. ,IZHUHXQLWHWKHGLIIHUHQWLQÁXHQFHVDQGPRWLIVRI WKH´,PDJHVRI'HDWKµLQWRDFRPSOH[ZKROHWKHIROORZLQJ PHVVDJHWDNHVRQDVXJJHVWLYHHIIHFWDQHVWDEOLVKHG period of the “universal history of Europe” has reached its HQG:HPXVWVHHNDQHZEHJLQQLQJ *** This text was written for the opening of the exhibition ´,PDJHVRI'HDWKµDWWKH.QVWOHUKDXV%HWKDQLHQ%HUOLQ by its director, Michael Haerdter. 7KHWUDYHOLQJH[KLELWLRQ´,PDJHVRI'HDWK3HUX RUWKH(QGRIWKH(XURSHDQ'UHDPµZLWKZRUNVE\WKH Grupo Chaclacayo of Peru (Helmut J. Psotta, Sergio Zevallos, and Raúl Avellaneda), arose as a result of a SURSRVDOE\WKH.QVWOHUKDXV%HWKDQLHQ,WKDVEHHQ exhibited in Lima, Stuttgart, Bochum, Karlsruhe, and West Berlin. At the DGR, the exhibition will be on display from May 9 to 27, 1990 at the Galerie am Weidendamm, Berlin; and from August 17 to October 30, 1990 at the 3UHGLJHUNLUFKHLQ(UIXUW 7KH´,PDJHVRI'HDWKµSURMHFWE\WKH*UXSR Chaclacayo was created between 1982 and 1988 in Peru. ,WLQFOXGHVGUDZLQJVREMHFWVVFXOSWXUHVSHUIRUPDQFHV DQGGRFXPHQWDWLRQ7KHUHVXOWVRIWKHVHULHVRIZRUN resulted in a large-scale general presentation. This exhibition presents only a limited selection compiling the different SHULRGVRIZRUN The performances by the artists of Chaclacayo WDNHSODFHRQ0D\DQGRQWKHVWXGLRVWDJH RI0D[LP*RUNL7KHDWHUVWDUWLQJDWSP H[WHQGHG opening hours). 152 153 (VWDELEOLRJUDItDSUHVHQWDXQDVHOHFFLyQGHPDWHULDOHVVREUHHO *UXSR&KDFODFD\R\HOUHFRUULGRSRVWHULRUGHVXVWUHVLQWHJUDQWHV 8QDRUJDQL]DFLyQSUHOLPLQDUIXHUHDOL]DGDHQSRU9DOWHU $ULFD6WHIDQLD3ROR(PLOLR7DUD]RQD\0LJXHO$/ySH]FRPRSDUWH GHDLPDUWHPRYLOL]DFLyQ/DUHYLVLyQ\DFWXDOL]DFLyQGHODFURQROR JtDSDUDHVWHOLEURIXHUHDOL]DGDSRU*DEULHOD*HUPDQi\0LJXHO$ /ySH]/DVHOHFFLyQHVWiRUGHQDGDFURQROyJLFDPHQWH\HVWiVXEGLYL GDHQOLEURVFDWiORJRV\DÀFKHVFRQIHUHQFLDV\SUHVHQWDFLRQHV\ HQWUHYLVWDV\DUWtFXORV/RVDUWtFXORVUHSURGXFLGRVHQHVWHOLEURHVWiQ LQGLFDGRVHQWUHSDUpQWHVLV Bibliografía Libros, catálogos y afiches Psotta, H. J. De vraag van het begin ²YHUVODJYDQHHQGLGDNWLVFKPHWKR GRORJLVFKJURQGVODJHQRQGHU]RHNLQ de beeldende kunst. Amsterdam: 5LMNVDNDGHPLHYDQ%HHOGHQGH.XQVten, 1971. La Torre, Alfonso. “La otra luz.” En *UXSR&KDFODFD\R3HU~«XQVXHxR. $ÀFKHGHH[SRVLFLyQ/LPD0XVHR GH$UWHGH/LPD,QVWLWXWR*RHWKH 20 de noviembre al 20 de diciembre de 1984 (Véase página 277). Originalmente publicado como La Torre, Alfonso. “Perú –¿un sueño?” Lima Kurier, Lima, n. 48 (octubre de 1984): 1—2. Schmied, Wieland. “Un sueño peruano.” En*UXSR&KDFODFD\R3HU~« XQVXHxR. $ÀFKHGHH[SRVLFLyQ Lima: Museo de Arte de Lima ,QVWLWXWR*RHWKHGHQRYLHPEUH al 20 de diciembre de 1984. (Véase página 276 ). Grupo Chaclacayo. Todesbilder: Peru oder Das Ende des europäischen 7UDXPVTextos de Nelly Sachs, Michael Haerdter, Wieland Schmied, $QGUHDV:R]LQFNHO3HWHU6SLHOPDQQ Cesar Vallejo, Helmut J. Psotta, Sergio Zevallos, y José María Arguedas. Berlin: Alexander Verlag, 1989. Birringer, Johannes H. Media and Performance: along the border. %DOWLPRUH-RKQV+RSNLQV8QLYHUVLW\ Press, 1998. _____Performance on the Edge: 7UDQVIRUPDWLRQVRI&XOWXUH New Jersey: The Athlone Press, 2000. Grupo Chaclacayo. 'HU2EV]|QH7RG HLQHV+HLOLJHQ Catálogo de exposición. Herne: Flottmann-Hallen, 11 al 26 de junio de 1991. )HVW,,,)HVWVSLHOKDXV+HOOHUDX. Folleto del festival. Dresden: Geschäftsstelle Dresden, 1994. Hernández Calvo, Max y Jorge Villacorta. )UDQTXLFLDV,PDJLQDULDV Las opciones estéticas en las artes SOiVWLFDVHQHO3HU~GHÀQGHVLJOR. /LPD)RQGR(GLWRULDOGHOD3RQWLÀFLD Universidad Católica del Perú, 2002. Gruppe Nebelhorn. .|SIH(LQ NQVWOHULVFKHV3URMHFWPLW%HKLQGHU WHQXQG1LFKWEHKLQGHUWHQ. Catálogo de exposición. Wesel: Städtisches Museum, 2002. hEHU.XQVWDP3UDWHU-DKUH Galerie am Prater, Berlin: Galerie am Prater, 2003. Castrillón Vizcarra, Alfonso y Pedro Pablo Alayza. /DJHQHUDFLyQGHO ORVDxRVGHODYLROHQFLD. Catálogo de H[SRVLFLyQ/LPD,&31$ 3VRWWD+HOPXW-\$UQGW%HFN $XWRSVLH²6WLOOVWDQGGHU Geschichte: Kapitel 1 der Berliner 7ULORJLH²'LH:HUWHBerlin: Karin Kramer Verlag, 2005. BBBBB $XWRSVLH²6WLOOVWDQGGHU *HVFKLFKWH.DSLWHOGHU%HUOLQHU 7ULORJLH²'DV1LFKWVBerlin: Karin Kramer Verlag, 2006. *UXSSH1HEHOKRUQ³ (LQH&KURQRORJLH Catálogo de exposición. Wesel: Städtisches Museum, 2006. Márquez, Alfredo, ed. ,QNDUUL9HVWLJLR Barroco. Catálogo de exposición. Lima: Centro Cultural de España, 2005. Alvarado, Luis, Paulo Dam, Augusto del Valle, Sharon Lerner, Miguel A. López y Jorge Villacorta. 3RVW,OXVLR QHV1XHYDVYLVLRQHV$UWHFUtWLFRHQ /LPD  . Lima: Fundación Wiese, 2006. Tarazona, Emilio. Accionismo en el 3HU~  5DVWURV\IXHQWHV SDUDXQDSULPHUDFURQRORJtDLima: ,QVWLWXWR&XOWXUDO3HUXDQR1RUWH americano, 2006. 3VRWWD+HOPXW-\$UQGW%HFN $XWRSVLH²6WLOOVWDQGGHU*HV FKLFKWH,QWHUPH]]R1DFKWCatálogo de exposición. Berlin: Fotogalerie Friedrichshain, 15 de setiembre al 2 de noviembre de 2007. Deborah Cullen, ed. $UWH9LGD Actions by artists of the Americas . Cataálogo de exposiFLyQ1XHYD<RUN0XVHRGHO%DUULR 2008, 152-161. +HOPXW-3VRWWDOLHVWDXVVHLQHP XQYHU|IIHQWOLFKWHQ5RPDQ. Volante e invitación a conferencia. Berlín: Studio im Hochhaus, noviembre de 2008. Die Sammlung Annette und Peter 1REHO. Catálogo de exposición. Bern: 6WlPSÁL &KULVW+DQV'H,ULV'UHVVOHUHGV 6XEYHUVLYH3UDFWLFHV$UWXQGHU Conditions of Political Repression: VV6RXWK$PHULFD(XURSH. &DWiORJRGHH[SRVLFLyQ2VWÀOGHUQ :UWWHPEHUJLVFKHU.XQVWYHUHLQ Stuttgart y Hatje Cantz Verlag, 2010. Quijano, Rodrigo. “Remesas: Flujos Simbólicos / Movilidades del Capital.” Folleto de exposición. Lima: Centro Fundación Telefónica, 6 de julio al 7 de octubre de 2012. López, Miguel A. y Eliana Otta, eds. ¢<TXpVLODGHPRFUDFLDRFXUUH" Catálogo de exposición. Lima: Ediciones delmasacá y Galería 80m2 Livia Benavides, 2012. Red Conceptualismos del Sur, ed. 3HUGHUOD)RUPD+XPDQD8QD LPDJHQVtVPLFDGHORVDxRVHQ América Latina. Catálogo de exposición. Madrid: Museo Nacional Centro de Arte Reina Sofía, 2012. Psotta, Helmut J. Radikale Poesie – )UKH$UEHLWHQ. $UQGW%HFNHG %HUOLQ.DULQ Kramer Verlag, 2013. Psotta, Helmut J. 8QUXKHVWLIWHQ² EHU3DEOR1HUXGD. Berlin: Karin Kramer Verlag, 2013. López, Miguel A. Reality can suck P\GLFNGDUOLQJ7KH0XVHR7UDYHVWL GHO3HU~DQGWKHKLVWRULHVZH GHVHUYH9LVLEOH²:RUNERRN. Biella: Cittadellarte – Fondazione Pistoletto, Fondazione Zegna, Kunsthaus Graz, 2013. López, Miguel A. y Sol Henaro, eds. 3XOVR$OWHUDGR,QWHQVLGDGHV HQOD&ROHFFLyQGHO08$&\VXV Colecciones Asociadas. Catálogo de exposición. México D.F.: Museo Universitario de Arte Contemporáneo, UNAM, 2013. &DOOHMyQ2VFXUR&RQFLHUWRSDUD XQDPHQWH\SDUODQWHV. Folleto de exposición. Lima: Museo de Arte Contemporáneo–Lima, 2013. Lerner, Sharon, ed. $UWH&RQWHPSR UiQHR&ROHFFLyQ0XVHRGH$UWHGH Lima. Lima: Museo de Arte de Lima, 2013. 154 Conferencias y textos inéditos Salazar de Alcázar, Hugo. “ChuangTse, Freud y el sueño peruano.” Texto inédito. Lima, ca. 1984-1985. Archivo Sergio Zevallos. (Véase página 116). Pollig, Hermann. “Todesbilder. Peru oder das Ende des europäischen Traums.” Texto inédito de discurso pronunciado en la apertura de la H[SRVLFLyQHQHO,)$6WXWWJDUWGH abril, 1989. Archivo Sergio Zevallos. ,QVWLWXWIU$XVODQGVEH]LHKXQJHQ “Pressemitteilung: Ausstellung ‘Todesbilder: Peru oder das Ende des europäischen Traums’µ Nota de prensa. Stuttgart, 4 de junio de 1989. Archivo Sergio Zevallos. (Véase página 285). Badischer Kunstverein. “Sonderveranstaltungen.” Nota de prensa. Karlsruhe, septiembre de 1989. Archivo Sergio Zevallos. Haerdter, Michael. “Todesbilder: Peru oder Das Ende des europäischer Traums.” Texto preparado para la apertura de la exposición HQ=HQWUXPIU.XQVWDXVVWHOOXQJHQ der DDR - Galerie am Weidendamm. *UXSR&KDFODFD\R Berlin, mayo de 1990. (Véase páginas 130-131). Rosner, Bernd. “Gruppe Chaclacayo. Todesbilder. Peru oder das Ende des europäischen Traums.” Texto inédito de discurso pronunciado para la apertura de la muestra del Grupo Chaclacayo en el Zentrum IU.XQVWDXVVWHOOXQJHQGHU''5 Berlin, 8 mayo 1990. Archivo Sergio Zevallos. 3UHVHQWDFLyQGHYLGHRVGRFXPHQWD les del artista multimedia alemán +-3VRWWD,QYLWDFLyQ\SURJUDPD de actividades. Santiago de Chile: *RHWKH,QVWLWXWGHQRYLHPEUH de 1998. 155 Psotta, Helmut J. Curriculum Vitae. 7H[WRQDUUDWLYRDXWRELRJUiÀFRGHVGH su nacimiento hasta el presente. Berlín, ca. 2009. Archivo Miguel A. López. Zevallos, Sergio. “A los organizadores y responsables de la exposición 9LJLODU\FDVWLJDU” (Carta pública circulada en internet sobre la exposición presentada en la Sala Luis Miró Quesada Garland en la que se exhibía imágenes del Grupo Chaclacayo sin consentimiento de los artistas y con información errónea sobre las obras). Lima, 15 de agosto de 2012. López, Miguel A. “Marica barroca asesina. Travestismo y ‘revolución’ comunista en el Perú de los años 80.” Texto inédito de conferencia presentada en Campceptualismos GHO6XU7URSLFDPSSROtWLFDVSHU formativas y subalternidad, Museo d’Art Contemporani de Barcelona, 19 y 20 de noviembre de 2012. Archivo Miguel A. López. Ferrari, Verónica. “Cuerpos obscenos: performance, insumisión y política. La imagen, el espejo, la historia que salva vidas.” Texto inédito de conferencia presentada en las actividades públicas de la exposición 8QFXHUSRDPEXODQWH, Museo de Arte de Lima, 10 de diciembre de 2013. Archivo Miguel A. López. Entrevistas y artículos “H. J. Psotta: todo y/o nada.” Lima Kurier, Lima, n. 25 (julio de 1982): 1-3. (Véase páginas 109-111). Alemann, Marilouisse. “Grenzgänger.” Argentinisches Tageblatt, Buenos Aires, 23 de julio de 1983, p. 17. Buntinx, Gustavo [Sebastián Gris]. “Una experiencia extrema en nuestro arte.” El Caballo Rojo, suplemento de El Diario Marka, Lima, 28 agosto 1983, pp. 10-11. A[dolph], J[oseph] B. “¿Qué pasa en Chosica?” Lima Kurier, Lima, n. 40 (diciembre de 1983): 1-3. (Véase páginas 112-114). Grupo Chaclacayo. “El grupo sobre sí mismo.” Lima Kurier, Lima, n. 40 (diciembre de 1983): 3. (Véase página 114). Buntinx, Gustavo “¿Entre lo popular y lo moderno? Alternativas pretendidas o reales en la joven plástica peruana.” Hueso Húmero, Lima, n. 18 (julio-setiembre de 1983 [1984]): 61-85. Salazar del Alcázar, Hugo. “Veleidad y demografía en el no-objetualismo peruano.” Hueso Húmero, Lima, n. 18 (julio-setiembre de 1983 [1984]): 112-121. “Mañana abren singular exposición.” El Comercio, Lima, 19 de noviembre de 1984, p. C13. M.F. “‘Perú, un Sueño’, original muestra pictórica del ‘Grupo Chaclacayo’ en el Museo de Arte.” Expreso, Lima, 23 de noviembre de 1984, p. 33. Critias. “¿Arte sado-masoquista?” 2LJD, Lima, 26 de noviembre de 1984, p. 61. López, Miguel A. “¿Dónde está la fotografía? Anotaciones sobre la imposibilidad.” Texto inédito de conferencia presentada en el I Encuentro Internacional sobre la Imagen Contemporánea – Mirafoto , Lima, Centro Fundación Telefónica, 2007. Archivo Miguel A. López. Silvestre, Miguel. “A propósito de una muestra de ‘Chaclacayo’: Cuando el ser auténtico resulta ser peligroso”. El Diario de Marka, Lima, 27 noviembre 1984, p. 18. (Véase página 115). 3VRWWD+HOPXW-´$VÀ[LDµ)UDJPHQWROHtGRGHVXQRYHOD$VÀ[LDHQHO Studio im Hochhaus, Berlin, 14 de noviembre de 2008. Archivo Helmut J. Psotta Bernuy, Jorge. “Visible inquietud de búsqueda.” El Comercio, Lima, 13 de diciembre de 1984. Psotta, Helmut J. Todesbilder. Texto inédito de presentación de los videos de las performances del Grupo Chaclacayo (1989-1991) en Studio im Hochhaus, Berlín, 10 de julio de 2009. Archivo Miguel A. López Lama, Luis E. “Pobre Goethe.” Caretas, Lima, 3 de diciembre de 1984, pp. 62-63. Buntinx, Gustavo [Sebastian Gris]. “‘Grupo Chaclacayo.’ Los cuerpos del delito.” La Republica, Lima, 9 de diciembre de 1984, p. 49. _____“Una recuperación penosa.” La República, Lima, 30 de diciembre de 1984. 0,9´+|OOHDXI(UGHQ7RGHVELOGHU aus Peru.” Stuttgarter Zeitung, Stuttgart, 19 de abril de 1989. 3HWHU&ODXGLD´6GDPHULNDQLVFKH .XQVWDXV/HLG:XWXQG(NHOµ 6WXWWJDUWHU1DFKULFKWHQStuttgart, n. 127 (6 de junio de 1989). (Véase página 119). W-M. “‘Todesbilder’: Die Geschichte Perus ist von Gewalt geprägt.” 5XKU1DFKULFKWHQ Dortmund, 15 de julio de 1989. %RHEHUV-UJHQ´.XQVWVSLHJHOWGDV Entsetzen. Peruanische ‘Todesbilder’ GHU.QVWOHUJUXSSH¶&KDFODFD\R·LP Museum.” WAZ, Essen, 15 de julio de 1989. _____“Spur der Gewalt. Bochum: Kunst aus den Anden Perus.” WAZ, Essen, 21 de julio de 1989. *,´3HUIRUPDQFH]XP(QGHGHU ‘Todesbilder’.” WAZ, Essen, 26 de agosto de 1989. >$XWRUQRLGHQWLÀFDGR@´7RGHVELOGHUµ =<0$.XQVWPDJD]LQ, Stuttgart, n. 2/3 (mayo-agosto de 1989). (Véase páginas 120-121). 6FKLOOHU6XVDQQH´%ODQNH%UVWH und Bilder von rotem Blut.” %11, Ettlingen, 21 de Septiembre de 1989. Lindner, Lia. “Grupo Chaclacayo, Peru: ‘Todesbilder’ – oder ‘Das Ende des europäischen Traums’.” 1LNH 1HZ$UWLQ(XURSH0QFKHQQ (octubre-noviembre de 1989): 56. Thiel, Heinz. “Todesbilder: Peru oder ‘Das Ende des europäischen Traums.’ Badischer Kunstverein, 21.09. – 29.10. 1989.” Kunstforum International,.|OQQ (noviembre-diciembre de 1989): 386–387. Lama, Luis E. “Perversión y complacencia.” Caretas, Lima, 20 de noviembre de 1989, pp. 74-76. 3DVHWD6DQWDQD,YR´$XVSLFLRLQ genuo.” (Carta enviada a la revista en reacción al artículo de Luis Lama). Caretas, Lima, 27 de noviembre de 1989, pp. 8, 88. ´3HUXNHLQ7UDXPµWD] Berlin, 26 de enero de 1990, p. 22. +DFNHQEHUJ'RURWKHH´9RP7RG umfangen: ‘Todesbilder’ der Grupo &KDFODFD\RLP.QVWOHUKDXV%HWKDnien.” WD] Berlin, 26 de enero de 1990, p. 22. +DFNHQEHUJ'RURWKHH´¶'LHVH %UXWDOLWlWGHU6DQIWKHLW·,QWHUYLHZ mit Helmut J. Psotta, RaÚl Avellaneda, Sergio Zevallos von der Grupo &KDFODFD\REHU¶7RGHVELOGHU·µ WD] Berlin, 26 de enero de 1990, pp. 22-23. (Véase páginas 122-123). +DFNHQEHUJ'RURWKHH´+HLOLJH Folter—Rosa!: Performance und QDWLRQDOH,QV]HQLHUXQJHQHLQHV peruanischen Symbols.” WD] Berlin, 26 de enero de 1990, p. 23. (Véase página 123). 5DVPXVVHQ+DQQDK+´,GHQWLW\ Card.” En Station to Station. Copenhagen: Danish Center for Culture and Development, 2000, pp. 38-41. García, Miguel. “Auténticos, Destructores, Forajidos y Amorosos: Políticas corporales y nuevas estéticas en una ciudad interminable.” En Jorge Bracamonte, ed. De amores y luchas: diversidad sexual, derechos KXPDQRV\FLXGDGDQtD. Lima: Centro de la Mujer Peruana Flora Tristán, 2001, pp. 231-252. Kuhlbrodt, Detlef. “Sprechen und :LHGHUKROHQ$XVGUXFNVVXFKWLP .QVWOHUKDXV%HWKDQLHQµWD], Berlin, 26 de enero de 1990, p. 23. Engmann, Rebecca K. “Digital Room Show.” .DWDORJ-RXUQDORI3KRWR graphy & Video, Odense, verano de 2001, p. 59. Nungesser, Michael. “Gebärmutter GHV%|VHQ'LHSHUXDQLVFKH*UXSSH &KDFODFD\RLP.QVWOHUKDXV%HWKDQLHQµ>3HULyGLFRQRLGHQWLÀFDGR@ Berlín, n. 13 (6 de febrero de 1990): 5. (Véase página 129). Lama, Luis. E. “Agtistucho.” Caretas, Lima, 19 de septiembre de 2002, p. 82. “‘Todesbilder’ in Berliner Galerie.” Berliner Allgemeine Zeitung, Berlin, 10 de mayo de 1990. Pretsch, Lutz. “Tabus gelten hier nicht: Todesbilder aus Peru.” Berliner Zeitung, Berlin, 22 de junio de 1990. Rosner, Bernd. “Todesbilder.” Bildende Kunst, Berlin, vol. 38, n. 9 (septiembre de 1990): 39-44. 3U|EVWO.DWKULQ´%OXWLJHV0DUW\ULXP als Mysterienspiel: Chaclacayo’s 6NXOSWXUDOV3UR]HVVµWAZ, Essen, 15 de junio de 1991. %XQWLQ[*XVWDYR´3OiVWLFD¶ ,,,  La investigación visual.” /D5HS~E lica, Lima, 22 de marzo de 1992, pp. 27-29. Limache, Óscar. “Jóvenes artistas: Tenemos Grupo Electrógeno.” 4XHKDFHU, Lima, n. 83 (marzo-abril de 1993): 92-102. +HU]IHOG,VDEHO´.XQVWXQG*HZDOW +HOOHUDX¶)HVW,,,·GHU(XURSlLVFKHQ :HUNVWDWWIU.XQVWXQG.XOWXUµ 'LVVRQDQ]'LVVRQDQFH, Zurich, n. 43 (febrero de 1995): 33-34. Lara B., Carolina. “La última acción de arte.” El Mercurio, Santiago de Chile, 25 de diciembre de 1998. Buntinx, Gustavo. “¿Por qué no vivo en el Perú? (Una generación después): Notas al sesgo de una encuesta.” Márgenes/LPDDxR;, n. 16 (diciembre de 1998): 135-232. “Digital Bodies.” Ballet International ²7DQ]$NWXHOO%HUOLQ<HDUERRN 1999, pp. 68-69. Del Valle, Augusto. “Las vicisitudes de la materia: una memoria interrumpida – la escultura contemporánea en el Perú.” En Marta Cisneros, Johanna Hamann y Miguel Mora, eds. +RPHQDMHD$QQD0DFFDJQR I Simposio sobre la escultura perua QDGHOVLJOR;; Lima: Fondo editorial GHOD3RQWLÀFLD8QLYHUVLGDG&DWyOLFD 2003, pp. 139-153. Tarazona, Emilio. “El Grupo Chaclacayo: Marcas de la violencia por debajo de la piel.” Arte Marcial, Lima, n. 3 (abril de 2003): 8-9. Niño de Guzmán, Guillermo. “Años perros: arte y terror en el Perú de los 80.” El Dominical, suplemento de El Comercio, Lima, 9 de mayo de 2004, pp. 8-9. López, Miguel A. y Eliana Otta. “Santos Híbridos de la avenida Abancay. Entrevista con Sergio Zevallos.” 3UyWHVLV, Lima, n. 3 (diciembre de 2005): 63-67. 0XQLYH0DQXHO´,QNDUUL9HVWLJLR barroco.” ,OODSD5HYLVWDGHO,QVWLWXWR GH,QYHVWLJDFLRQHV0XVHROyJLFDV\ $UWtVWLFDVGHOD8QLYHUVLGDG5LFDUGR Palma, Lima, n. 2 (diciembre de 2005): 127-128. Lerner, Sharon y Jorge Villacorta. “Fragmented Corpus: Actions in Lima, 1966-2000.” En Deborah Cullen, ed. $UWH9LGD$FWLRQVE\ DUWLVWVRIWKH$PHULFDV. &DWDiORJRGHH[SRVLFLyQ1XHYD<RUN Museo del Barrio, 2008, 152-161. 6FKPLHG:LHODQG´,Q3HUXµ\ “Machu Pichu – ein Traum.” En /XVWDP:LGHUVSUXFKStuttgart: Raduis-Verlag GmbH, 2008, pp. 352-354. Nogueira, Fernanda. “Subversive Practices.” Artecontexto, Madrid, n. 23 (2009): 102-103. Tarazona, Emilio. “Soñando sin dormir, al ojo abierto. Una (abreviada) conversación con Helmut J. Psotta.” ,OODSD5HYLVWDGHO,QVWLWXWR GH,QYHVWLJDFLRQHV0XVHROyJLFDV\ $UWtVWLFDVGHOD8QLYHUVLGDG5LFDUGR Palma, Lima, n. 6 (diciembre de 2009): 85-92. Pillado-Matheu, Santiago. “Arte clandestino del Perú en Alemania.” Cosas, Lima, 3 de setiembre de 2009, pp. 106-109. López, Miguel A. “Discarded Knowledge. Peripheral Bodies and Clandestine Signals in the 1980s :DULQ3HUXµ(Q,YDQD%DJR $QWRQLD0DMDFD\9HVQD9XNRYLF eds. 5HPRYHGIURPWKH&URZG 8QH[SHFWHG(QFRXQWHUV,. Zagreb: BLOK y DeLVe, 2011, pp. 102-141. Pérez, Ailen. “El arte del poder.” Caretas, Lima, 19 de julio de 2012, pp. 108-109. Podestá, Cecilia. “La ira del poder: 30 años de censura.” 'LDULR, Lima, 25 de julio de 2012, pp. 8-9. Tarazona, Emilio. “Cenizas del Grupo Chaclacayo.” &DUWD5HYLVWDGHO 0XVHR1DFLRQDO&HQWURGH$UWH 5HLQD6RItD, Madrid, n. 3 (primavera-verano, 2012): 63-67. Zevallos, Sergio. “Traición a la patria.” En Miguel A. López y Eliana Otta, eds. ¢<TXpVLODGHPRFUDFLD RFXUUH" Catálogo de exposición. Lima: Ediciones delmasacá y Galería 80m2 Livia Benavides, 2012, p. 101. Tarazona, Emilio. “Cuerpos y Flujos.” En Red Conceptualismos del Sur, ed. 3HUGHUOD)RUPD+XPDQD8QD LPDJHQVtVPLFDGHORVDxRV en América Latina. Catálogo de exposición. Madrid: Museo Nacional Centro de Arte Reina Sofía, 2012, pp. 85-91. Longoni, Ana y Miguel A. López. ´,QVHSXOWRµ(Q5HG&RQFHSWXDOLVPRV del Sur, ed. 3HUGHUOD)RUPD+XPDQD 8QDLPDJHQVtVPLFDGHORVDxRV en América Latina. Catálogo de exposición. Madrid: Museo Nacional Centro de Arte Reina Sofía, 2012, pp. 128-130. Jiménez, Carlos. “Perder la Forma Humana. Una imagen sísmica de los años 80 en América Latina.” Artnexus, Bogotá, vol. 12, n. 88 (marzo-mayo de 2013): 68-72. De Llano, Pedro. “The Sentient Memory of Latin America. On ‘Losing the Human Form’ at Museo Nacional Centro de Arte Reina Sofía Madrid.” 7H[WH]XU.XQVW, Berlin, n. 90 (junio de 2013): 254-257. De Benito Fernández, Álvaro. “Perder la Forma Humana. Una imagen sísmica de los años 80 en América Latina.” $UWHDO'tD,QWHUQDFLRQDO, Miami, n. 142 (abril-junio de 2013): 77-79. López, Miguel A. “Queer Corpses: *UXSR&KDFODFD\RDQGWKH,PDJH of Death.” ()OX[-RXUQDO1HZ<RUN n. 44 (abril de 2013). Chueca, José Gabriel. “El arte valiente de los ochenta.” Poder ƒ, Lima, n. 50 (abril de 2013). López, Miguel A. y Fernanda Nogueira. “The Cuir Machine.” 5HYLHZ/LWHUDWXUHDQG$UWVRIWKH $PHULFDV1HZ<RUNYRO n. 1 (mayo de 2013): 117-125. León Xjiménez, Carlos. “Perder la Forma Humana. Mapeando las huellas de la resistencia crítica.” Art Motiv, Lima, abril-agosto 2013, pp. 70-71. López, Miguel A. “Fosa Común.” &DUWD5HYLVWDGHO0XVHR1DFLRQDO &HQWURGH$UWH5HLQD6RItD, Madrid, n. 4 (primavera-verano de 2013): 56-58. _____“Cuerpos fallidos, trance, enfermedad y deseo social / Failed ERGLHVWUDQFHVLFNQHVVDQGVRFLDO desire.” En López, Miguel A. y Sol Henaro, eds. 3XOVR$OWHUDGR,QWHQ VLGDGHVHQOD&ROHFFLyQGHO08$&\ sus Colecciones Asociadas. Catálogo de exposición. México D.F.: Museo Universitario de Arte Contemporáneo, UNAM, 2013, pp. 16-27. “Miguel A. López in Conversation with Cecilia Fajardo-Hill / Miguel A. López en conversación con Cecilia Fajardo-Hill.” $UWHDO'tD,QWHUQD cional, Miami, n. 143 (julio-octubre de 2013): 92-97. López, Miguel A. “Ornamentos. )ORUHV7UiÀFRVHVSXULRV-DLPH+LJD / Historia invertida.” En 2UQDPHQWR -DLPH+LJD$QWRORJtDPtQLPD  . Catálogo de exposición. Lima: Centro Cultural Ccori Wasi de la Universidad Ricardo Palma, 2013. _____“F(r)icciones Cosmopolitas. 5HGHÀQLFLRQHVHVWpWLFDV\SROtWLFDV de una idea de vanguardia en los años 60.” En Sharon Lerner, ed. $UWH&RQWHPSRUiQHR&ROHFFLyQ Museo de Arte de Lima. Lima: Museo de Arte de Lima, 2013, pp. 16-45. 156 Villacorta, Jorge, ed. “¿Un arte visual a contrapelo de los dictados metropolitanos? Conversación en torno a la Colección de Arte Contemporáneo Peruano del Museo de Arte de Lima.” En Sharon Lerner, ed. $UWH&RQWHPSRUiQHR&ROHFFLyQ Museo de Arte de Lima. Lima: Museo de Arte de Lima, 2013, pp. 315-361. “Realizan exposición sobre la obra de Sergio Zevallos. Se recuerda su paso por el grupo artístico Chaclacayo.” El Peruano, Lima, 5 de noviembre de 2013, p. 15. “Presentan exposición Un cuerpo ambulante de Sergio Zevallos”. 5331RWLFLDV, 8 de noviembre de 2013, http://www.rpp.com.pe/ 2013-11-08-presentan-exposicion -un-cuerpo-ambulante-de-sergiozevallos-noticia_646238.html “Regreso a los ochenta. Muestra en torno a la obra de Sergio Zevallos se verá desde este sábado.” La Primera. Lima, 11 de noviembre de 2013, p. 17. “Un cuerpo ambulante de Sergio Zevallos.” Expreso. Lima, 13 de noviembre de 2013, p. 15. “Polémico y visceral: el cuerpo ambulante de Sergio Zevallos.” 'LDULR, 16 de noviembre del 2013, pp. 8-9. Bermeo Ocaña, Óscar. “Cuerpos que describen una sociedad intensa.” El Comercio. Lima, 19 de noviembre de 2013, p. C2. “Un Cuerpo Ambulante. Sergio Zevallos en el Grupo Chaclacayo (1982-1994).” Arte en la red, 19 de noviembre de 2013, http://www. arteenlared.com/latinoamerica/ mas-de-latinoamerica/un-cuerpoambulante-sergio-zevallos-en-elgrupo-chaclacayo-1982-1994.html Palla, Tatiana. “Espacio de liberación.” Somos, revista de El Comercio, Lima, 23 de noviembre de 2013, p. 88. Podestá, Cecilia. “Una santa travestida y real”, La Mula, 24 de noviembre de 2013, https://lamula.pe/2013/ 11/24/una-santa-rosa-travestida-yreal/ceciliapodesta/ 5DPRV9DQ'LFN0DQXHO´3ODVPDU en un espejo tu imagen.” Velaverde, Lima, n. 41 (9 de diciembre de 2013): 57. Lama, Luis E. “Leteo”. Caretas, Lima, 12 de diciembre, 2013, p. 64. Cabral, Ernesto. “¡Blasfemia en el 0$/,µEl útero de Marita, 20 de diciembre de 2013, http://utero. pe/2013/12/20/blasfemia-mali/ Melgar, Ginno P. “El arte no es blasfemia”, La Mula, 20 de diciembre de 2013, https://redaccion. lamula.pe/2013/12/20/el-arteno-es-blasfemia/ginnopaulmelgar/ “‘Un cuerpo ambulante’ o la muestra blasfema.” Sensorio común, 21 de diciembre de 2013, http://sensoriocomun.blogspot.co.at/2013/12/ un-cuerpo-ambulante-o-la-muestra. html “Pintura de artista Sergio Zevallos es cuestionada por grupo católico.” La República, Lima, 21 de diciembre de 2013. Valcárcel, Karina. “El trance de la performance.” Velaverde, Lima, n. 43 (23 de diciembre de 2013): 58-61. “A ‘arte’ do inferno: exposição blasfematória no Peru.” Dominus Est, 26 de diciembre de 2013, http:// catolicosribeiraopreto.wordpress. com/2013/12/26/a-arte-do-infernoexposicao-blasfematoria-no-peru/ “Pérou: une exposition d’atrocités blasphématoires et obscènes pour ‘préparer’ Noël.” L’observatoire de la Christianophobie, 26 de diciembre de 2013, http://www.christianophobie.fr/breves/perou-une-exposition-datrocites-blasphematoireset-obscenes-pour-preparer-noel Mejía Vega, Yonatan. “Dos exposiFLRQHVHQHO0$/,\WUHVUD]RQHVSDUD visitarlas.” Lima gris, 31 de diciembre de 2013, http://www.limagris. com/dos-exposiciones-en-el-mali-y-tres-razones-para-visitarlas/ Otta, Eliana. “Travistiendo una santa para que sea de Lima.” Mujeres Batalla, Lima, n. 18 (diciembre de 2013): 60. Munive, Manuel. “Un cuerpo lacerado.” Lundero, suplemento de La Industria, Chiclayo-Trujillo, diciembre de 2013, pp. 14-15. 5DPRV9DQ'LFN0DQXHO´3HUGHU la forma humana.” Velaverde, Lima, n. 45 (10 de enero de 2014): 72. Blásica, Miguel. “Los muertos permanecen jóvenes.” 6DFURUHEHOGH, 29 de enero de 2014, http://sacro-rebelde.blogspot.com/2014 /01/los-muertos-permanecenjovenes-las.html Martin Rivas, Patricia. “Últimos días para ver la polémica muestra de Sergio Zevallos.” (VSDFLR, 11 de marzo de 2014, http://espacio 360.pe/noticia/cultura/Ultimosdias-para-ver-la-polemica-muestrade-sergio-zevallos-en-el-mali-61e3#. 8]'*O(MN Fonseca, Raphael. “Pulso Alterado.” $UW1H[XV, Miami, n. 92, vol. 13 (marzo-mayo 2014), pp. 122-124.